KEGG   Bacillus subtilis BSn5: BSn5_19690Help
Entry
BSn5_19690        CDS       T01417                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
bsn  Bacillus subtilis BSn5
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:bsn00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:bsn00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3796826..3798310
Genome map
AA seq 494 aa AA seqDB search
MKLTKLLTYLTTEPSVNDSQDPEITSIEMDSREVKKGSLFVCVKGYTVDGHDFAQKAVEN
GAAAIVAEREVDVNVPVIIVRQSLRALSVLSDAFYGQPTKKLQLIGITGTNGKTSTTHMV
DEILKKAGKRTGLIGTMYMKIGDETLPVKNTTPESVTLQKTFKKMNDKHVDTAIMEVSSH
ALSLGRVHGCDYDIAVFTNLTQDHLDYHKTMDEYRHAKSLLFSQLGGAFNHEHPKRAVLN
ADDEASAYFEKVTAAHISTYGIKNDADVMAKNISITAQGTSFDLVTNKGTKHITMSLVGQ
FNVYNVLAAVATCIAAGIPFEIITEAVEELHGVRGRFELVNQQQEFPVIVDYAHTPDSLE
NVLETCRDMTEGKLFVVVGCGGDRDKTKRPKMAKIAVELADEPIFTSDNPRSEDPRAILR
DMEAGVENAYYHSIANREQAIFFAIANAKKGDVVLIAGKGHETYQQIGNETFDFDDAEVA
ARAIVELNKNKTNS
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgaaacttacaaagctgcttacatacttaacaaccgaaccttctgtaaacgactcacaa
gaccctgaaataacttcaattgagatggactccagggaagtaaagaaagggagtcttttt
gtatgtgtaaaagggtatacggtggatggccacgattttgcgcaaaaagcagtagaaaac
ggtgcagcggctattgtggcagaaagagaggtcgatgtgaatgttcctgttattattgtc
cggcagtcacttcgcgcgctcagcgttttgtctgatgcgttttacggacagccgacgaag
aagcttcagctgattgggataacagggacaaacggcaaaacatcaacgacccacatggtc
gatgagattctgaaaaaagcgggaaaacgcacaggcttgatcggtacaatgtacatgaaa
atcggagacgaaacacttcctgttaaaaacacgactccggaaagcgtcacgctgcagaaa
acgtttaagaaaatgaatgacaagcatgttgacactgcaatcatggaggtttcttcccac
gctttgtctttaggacgcgtccatggctgtgattatgatattgccgtgtttacgaattta
acacaggaccatctggactatcataaaacgatggatgagtaccggcatgcaaaaagcttg
ctcttttcccaacttggcggggctttcaaccatgaacatccaaagcgtgccgtcctgaat
gctgacgatgaggcgagcgcttattttgaaaaggtaacagctgcgcatatctctacatac
ggaattaaaaacgatgctgatgtgatggcgaagaacatcagtatcactgcacagggcaca
agctttgatctcgtgacaaacaaaggcacgaagcacatcacgatgtctctcgtcggacaa
tttaatgtgtataacgtgctggccgctgttgcgacatgtattgcagcaggcataccgttt
gaaatcatcactgaagctgttgaagaattgcatggtgtaagaggccgttttgaattggtc
aatcagcagcaggagtttcctgtcattgtagactacgcgcacacaccggacagccttgaa
aatgtgctggagacatgcagagacatgacggaaggaaagctatttgtcgttgtcggctgc
ggaggagacagagataagacgaagcgcccgaaaatggctaaaattgctgtggagctggct
gacgagccgattttcacgtcagataacccgagaagcgaagatcctcgcgcgattttaaga
gatatggaagccggagtagagaacgcatactatcacagtattgcaaaccgcgagcaggcg
atctttttcgcaattgccaatgccaaaaaaggcgacgttgtcctcattgccggaaaagga
catgaaacctatcagcagatcggaaatgaaactttcgattttgatgatgctgaagtagcg
gcgagagccattgttgaactcaataagaataagacgaattcatag

DBGET integrated database retrieval system