KEGG   Bacillus subtilis subsp. natto BEST195: BSNT_01220Help
Entry
BSNT_01220        CDS       T02607                                 

Gene name
lplD
Definition
hydrolytic enzyme
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
bso  Bacillus subtilis subsp. natto BEST195
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:bso00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    BSNT_01220 (lplD)
  Lipid metabolism
   00561 Glycerolipid metabolism
    BSNT_01220 (lplD)
   00600 Sphingolipid metabolism
    BSNT_01220 (lplD)
Enzymes [BR:bso01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     BSNT_01220 (lplD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
770359..771702
Genome map
AA seq 447 aa AA seqDB search
MFHISTLDQIKIVYIGGGSQGWARSLMSDLSIDERMSGTVALYDLDFEAAQKNEVIGNHS
GNGRWRYEAVSTLKKALSAADIVIISILPGSLDDMEVDVHLPERCGIYQSVGDTVGPGGI
IRGLRAVPIFAEIARAIRDYAPESWVINYTNPMSVCTRVLYKVFPGIKAIGCCHEVFGTQ
KLLAEMVTERLGIEVPRREDIRVNVLGINHFTWITKASYRHIDLLPIFREFSAHYGESGG
YELEGESWRDSVFCSAHRVAFDLFETYGAIPAAGDRHLAEFLPGPYLKQPEVWKFHLTPI
SFRKQDRAEKRQETERLIVQQRGVAEKASGEEGVNIIAALLGLGELVTNVNMPNQGQVSN
LPIQAIVETNAFITRNRVQPILSGALPKGVEMLAARHISNQEAVAEAGLTKDTGLAFQAF
LNDPLVQIDRSDAEQLFNDMLQCIMQR
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
gtgtttcatatcagtacattagatcagattaagattgtctatattggcggggggtcccaa
ggctgggccagaagcctgatgagtgatttgtcgattgatgaacgtatgtcaggcacggtg
gcgctctatgatcttgattttgaagccgctcagaaaaatgaagtgatcggcaatcacagc
gggaacggcagatggagatatgaggctgtttctactttgaaaaaggcgttatcagccgcg
gatatcgtcattatttccattttgccgggatcactggatgatatggaagtcgatgtccac
ttgcctgagcgctgcggtatttatcagtctgtaggtgatactgtcgggcctggagggatc
atcaggggcttgcgtgctgtgccgatatttgcggaaattgcccgggcaataagagactac
gcacctgaatcatgggtcattaattatacaaacccgatgtctgtctgtacaagagtgctg
tataaagtgtttcccggcatcaaagcgattggctgctgccacgaggtattcgggacgcaa
aagttattggcggaaatggtcacggaaaggctggggattgaggtgccgcggcgtgaagat
atccgcgttaatgtgctcggcattaaccattttacatggatcacaaaagcctcttaccgc
catattgacctgctgcctatattccgtgaattcagcgcgcactatggggaatcaggagga
tatgagctggagggggaaagctggagggacagcgtcttttgttcggcacaccgtgttgcg
tttgatttatttgaaacgtatggcgccatccctgctgcgggagacaggcatctggcagag
tttcttcccggcccatacctcaaacagcctgaagtatggaaatttcatctcacacctata
tcattcagaaaacaagacagagctgagaaacgacaagaaacagaacggttgatcgtgcaa
caacgaggcgttgctgagaaagcttcgggagaagaaggcgtgaatatcatagcggctctt
ctcggattgggtgaactcgtcacaaatgtaaatatgccgaatcaaggccaggtctcaaac
cttcctatacaagccattgtcgaaacaaacgcattcatcacaaggaaccgtgtccagccg
attttgtccggagcgcttccgaaaggtgtggaaatgctggcggctaggcatatatccaat
caggaggcagtggcggaagcaggtttaacaaaggacactggcctcgcgtttcaagccttc
ctcaatgacccgcttgtccagattgaccgcagtgatgcagagcagcttttcaatgacatg
ctccaatgcatcatgcaacgttga

DBGET integrated database retrieval system