KEGG   Bacillus subtilis subsp. natto BEST195: BSNT_01238Help
Entry
BSNT_01238        CDS       T02607                                 

Gene name
yetO
Definition
hypothetical protein
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
bso  Bacillus subtilis subsp. natto BEST195
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Class
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:bso00071]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:bso00380]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:bso00627]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
780303..783488
Genome map
AA seq 1061 aa AA seqDB search
MKETSPIPQPKTFGPLGNLPLIDKDKPTLSLIKLAEEQGPIFQIHTPAGTTIVVSGHELV
KEVCDEERFDKSIEGALEKVRAFSGDGLFTSWTHEPNWRKAHNILMPTFSQQAMKDYHEK
MVDIAVQLIQKWARLNPNEVVDVPGDMTRLTLDTIGLCGFNYRFNSYYRETPHPFINSMV
RALDEAMHQMQRLDVQDKLMVRTKRQFRHDIQTMFSLVDSIIAERRANGDQDEKDLLARM
LNVEDPETGEKLDDENIRFQIITFLIAGHETTSGLLSFATYFLLKHPDKLKKAYEEVDRV
LTDAAPTYKQVLELTYIRMILNESLRLWPTAPAFSLYPKEDTVIGGKFPITTKDRISVLI
PQLHRDRDAWGKDAEEFRPERFEHQDQVPHHAYKPFGNGQRACIGMQFALHEATLVLGMI
LKYFTLIDHENYELDIKQTLTLKPGDFHIRVQSRHQEAIHADVQTAEKAAPDEQKEKTEA
KGASVIGLNNRPLLVLYGSDTGTAEGVARELADTASLHDVRTETAPLNDRIGKLPKEGAV
VIVTSSYNGKPPSNAGQFVQWLQEIKPGELEGVHYAVFGCGDHNWASTYQYVPRFIDEQL
AEKGATRFSGRGEGDVSGDFEGQLDEWKKSMWADAIKAFGLELNENADKERSTLSLQFVR
GLGESPLARSYEASHASIAENRELQSADSDRSTRHIEIALPPDVEYQEGDHLGVLPKNSQ
TNVSRILHRFGLKGTDQVTLSASGRSAGHLPLGRPVSLYDLLSYSVEVQEAATRAQIREL
AAFTVCPPHRRELEELSAEGVYQEQILKKRISMLDLLEKYEACDMPFERFLELLRPLKPR
YYSISSSPRVNPRLASITVGVVRGPAWSGRGEYRGVASNDLAERQAGDDVVMFIRTPESR
FQLPEDPETPIIMVGPGTGVAPFRGFLQAREVLKREGKTLGEAHLYFGCRNDRDFIYRDE
LEQFEKDGIVTVHTAFSRKEGMPKTYVQHVMADHAETLISILDRGGRLYVCGDGSKMAPD
VEAALQKAYQSVHGTGEQEAQNWLRHLQDTGMYAKDVWAGI
NT seq 3186 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaaacaagcccgattcctcagccgaagacgtttgggccgctcggcaatttgcct
ttaatcgataaagacaagccgacgctttcgctgatcaaactggcggaagaacagggccca
atttttcaaatccatacacccgcgggcacgaccattgtagtgtccggccacgaattggtg
aaagaggtttgtgatgaagaacggtttgataaaagcattgaaggcgccttggaaaaggtt
cgcgcattttccggtgacggattgtttacgagctggacgcatgagcctaactggagaaaa
gcgcacaacattctgatgccgactttcagccagcaggccatgaaggactatcatgagaaa
atggtcgatatcgctgttcagctcattcaaaaatgggcaaggctcaacccgaatgaagta
gtcgatgtcccgggagatatgacccggctgacgctcgacaccattgggctatgcgggttt
aactaccgctttaacagttactacagagaaacgccccacccgtttatcaacagcatggtg
cgggcgcttgatgaagcgatgcatcaaatgcagcggcttgatgttcaagataagcttatg
gtcagaacaaaacggcaattccgccatgatattcaaacgatgttttcgttagtcgacagc
attattgcagagcgcagggcgaatggagaccaggatgaaaaagatttgctcgcccgcatg
ctgaatgtggaagatccggaaacgggtgaaaagctcgacgacgaaaatatccgctttcaa
atcattacgtttttgattgccggccatgaaacaacgagcggcctgctttcctttgcgact
tactttttattgaagcatcctgacaaactgaaaaaggcgtatgaagaggtcgatcgggtg
ctgacggatgcagcgccgacctataaacaagtgctggagcttacatacatacggatgatt
ttaaatgaatcactgcgcttatggccgacagctccggctttcagcctttatccaaaagaa
gatacagtcattggcgggaaattcccgatcacgacgaaagacagaatttctgtgctgatt
ccgcagcttcatcgtgatcgagacgcttggggaaaggacgccgaggaattccggccggaa
cggttcgagcatcaggaccaagtgcctcatcatgcgtacaaaccattcggaaatggacaa
cgggcctgtatcggcatgcagtttgcccttcatgaagccacacttgtgttaggcatgatt
ctaaaatatttcacattgattgatcatgagaattatgagcttgatatcaaacaaacctta
acacttaagccgggcgattttcacatcagggttcaaagccgtcatcaggaagccattcat
gcggacgtccagacagctgaaaaagccgcgcctgatgagcaaaaggagaaaacggaagca
aagggcgcatcggtcatcggtcttaacaaccgcccgcttctcgtgctgtacggctcagat
accggcaccgcagaaggcgtcgcccgggagcttgctgatactgccagtcttcacgacgta
aggacagagacagcacctctgaacgaccggattggaaagctgccgaaagagggagcggtt
gtcattgtgacctcgtcttataatggaaagccgccaagcaatgccggacaattcgtgcag
tggcttcaagaaatcaaaccgggtgagcttgagggcgtccattacgcggtatttggctgc
ggcgaccacaactgggcgagcacgtatcaatacgtgccgagattcattgatgagcagctt
gcagaaaaaggcgcgactcggttttctgggcgcggggaaggggatgtcagcggtgatttt
gaagggcagcttgacgagtggaaaaaaagcatgtgggcggatgccatcaaagcattcgga
cttgagcttaatgaaaacgcagataaggaacgaagcacgctgagccttcagtttgtcaga
gggctgggcgagtctccgctcgctagatcgtacgaagcctctcacgcatccattgccgaa
aatcgtgaactccagtccgcagacagcgatcgaagcactcgccatatcgaaattgcattg
ccgccggatgttgaatatcaagagggcgaccatcttggcgtattgccaaaaaacagccaa
accaatgtcagccggattctccacagattcggcctgaagggcaccgaccaagtgacattg
tcggcaagcggccgcagtgcggggcatctgccattgggccgtcctgtcagcctgtatgat
cttctcagctacagcgtcgaggtgcaggaagcagccacaagagcgcaaatacgtgaactg
gcggcatttacagtgtgtccgccgcataggcgtgaattagaagaactgtcagcagagggt
gtttatcaggagcaaatattgaaaaaaagaatttccatgctggatctgcttgaaaagtac
gaagcgtgcgacatgccgtttgaacgatttttagagcttttacgtccgttaaaaccgaga
tattattcaatttcaagctctccaagagtgaatccgcggctagcatcgatcacagtcggc
gtcgtgcgcggccctgcgtggagcggccgtggcgaatacaggggcgtggcatcaaatgat
ttagctgagcgtcaagcgggtgatgatgtcgtgatgtttatccgcacaccggaatcccgg
tttcagcttccggaagaccctgaaacgccaatcattatggtcggacctggcacgggagtc
gcgccattccgcggtttccttcaagcccgcgaagttttaaagcgggaggggaaaacgctc
ggtgaagctcatctctattttggatgcaggaacgatcgtgattttatataccgcgatgaa
cttgagcagtttgaaaaagacggaattgtcactgtccacacagccttttcccgcaaagaa
ggcatgccgaaaacgtatgtccagcatgtcatggctgaccatgcagaaacgttaatatcg
atccttgaccgcggaggcaggctttatgtatgcggtgacggcagcaaaatggccccggat
gtggaggcggcactgcaaaaggcgtatcagtctgttcatggcaccggggagcaagaagcg
caaaactggctgagacatctgcaggataccggtatgtacgctaaggatgtctgggcaggg
atatag

DBGET integrated database retrieval system