KEGG   Bacillus subtilis subsp. natto BEST195: BSNT_02075Help
Entry
BSNT_02075        CDS       T02607                                 

Gene name
yjjA
Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
bso  Bacillus subtilis subsp. natto BEST195
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bso00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BSNT_02075 (yjjA)
Enzymes [BR:bso01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     BSNT_02075 (yjjA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1302873..1303685
Genome map
AA seq 270 aa AA seqDB search
MGKGLLGKRVAIGGSRKTEEISTIIEKQGGIPVIRPLQGTVYLAEKQVEPDLRTFAEEKA
DWVIFTTGIGLETLVDMAEKIGLKDEFLQAIRQAKAACRGYKTLSALKKLGITPEASDED
GTTRGLIRSLEPHDFSGKTVMVQLHGEKAPALMAFLEEKGASVLPILPYQHIPPEEETVE
QLCRELMNDEVDAVCFTTAIQVRSLFDFAKGRGYINEVKKVFEERAIAAAVGKVTAEALR
EEGITRLLAPEIERMGAMIVELAKYYEEKE
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaagggttacttggaaaacgcgtggcaatcggtggctcacgaaaaacggaagaa
attagtacaatcattgaaaaacagggcggaatacctgtcatccggcctctccaaggtaca
gtttacttagcagagaagcaggtggagccggatttgcggacgtttgcggaagaaaaagct
gactgggtcattttcacgacaggcatcgggttggagactcttgtcgatatggcagagaaa
attggactgaaagatgagtttctgcaggccattcgccaagcgaaagcggcatgccgggga
tacaaaacgctgtctgcgctgaaaaagcttggaatcacaccggaagcttcggatgaagac
gggacaacaagaggcttaatccgttccttggagcctcacgacttttcaggaaaaacagtc
atggtgcagcttcatggcgaaaaagcgccggctctcatggcatttcttgaagaaaaaggc
gcgtctgtcctgccgattctgccttatcagcacatcccgccggaggaggaaacggtggag
cagttatgccgagagctgatgaacgatgaggtcgatgccgtttgttttacaacggccatt
caggttcgttccctgtttgattttgccaaggggcgaggttatatcaatgaagtgaagaag
gtattcgaagaacgcgccatcgcagctgctgtcggaaaagtgactgctgaagcactgcgg
gaagagggcattacgagactgcttgcgccagagattgagcggatgggtgcgatgattgtt
gagctggccaagtattatgaagaaaaggaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system