KEGG   Bacillus subtilis subsp. natto BEST195: BSNT_02205Help
Entry
BSNT_02205        CDS       T02607                                 

Gene name
proB
Definition
gamma-glutamyl kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
bso  Bacillus subtilis subsp. natto BEST195
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bso01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:bso00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1389541..1390638
Genome map
AA seq 365 aa AA seqDB search
MKKQRIVVKIGSSSLTNSKGSIDEAKIREHVQAISVLKKAGHEMILITSGAVAAGFSSLG
YPSRPVTIKGKQAAAAVGQTLLMQQYMNQFKQYSLTPGQILLTRNDFSKRERYRNAYATI
MELLERGVIPIINENDSTSVEELTFGDNDMLSALVSGLIHADQLMILTDINGLYDANPNE
NPEAKRFDYLPEITPELLGYAGSAGSKVGTGGMKSKLLAAQTALSLGVKVFIGTGSGEQK
LADILDGRGDGTYIGDKELSSVNNTRQWIQFHSPISGEIIIDAGAEEAMIHNGSSLLPAG
VVGVNGSFPKGAVVEVRGPGGVIGKGQTHYSSEEIMEAKGKRSDELDFEKTFEVIHRNDW
VNVKD
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacaaagaatagtagtgaaaataggaagcagttcgctcacaaatagcaaagga
agcattgatgaggcaaaaatcagagagcatgttcaggccatttccgtgttaaaaaaagcg
gggcatgaaatgattctgattacctcgggtgccgtagcggcggggttttccagcctcggt
tatccgtcccgtcccgttaccatcaaaggaaaacaggcggcggccgcggtcggacaaaca
ctgttaatgcagcaatatatgaatcaatttaaacaatactcactgactccgggacaaatc
cttttaacgagaaatgatttttcgaaaagagaacggtatcgaaacgcgtatgctacgata
atggaattattagagcggggcgtcattccgattatcaacgagaacgattctacatctgtt
gaagaattgacattcggagataatgatatgctttctgcgttagtcagcggattgattcac
gcggaccagctcatgattctcaccgacattaacggactgtatgatgccaatccaaatgaa
aatcctgaggcgaaacgatttgattatttgccggagatcacgcctgaattgcttggatat
gcaggttcagccggatcaaaggtcggcaccggcggaatgaaatcaaagctgttagccgca
caaaccgcgctgtctctgggagtgaaagtattcattggaacaggcagcggagagcaaaaa
cttgcggatattttggacggcaggggagacggcacttatatcggagacaaagaactatct
tcggttaacaacacaaggcagtggattcagttccactcgccgatatcgggagaaattatc
attgatgcgggtgccgaggaggcgatgatccataatggaagcagccttttgcccgctggc
gttgtgggtgtgaacggaagctttccgaaaggggcggttgtggaagtcaggggaccgggc
ggcgtgatcggcaaaggccaaacccattactcctctgaggagattatggaggccaagggc
aaacgcagtgacgaacttgattttgagaaaacgtttgaggttattcataggaatgactgg
gtcaatgtaaaagactag

DBGET integrated database retrieval system