KEGG   Bacillus subtilis subsp. natto BEST195: BSNT_02251Help
Entry
BSNT_02251        CDS       T02607                                 

Gene name
ligD
Definition
ATP-dependent DNA ligase
Orthology
K01971  
DNA ligase (ATP) [EC:6.5.1.1]
Organism
bso  Bacillus subtilis subsp. natto BEST195
Pathway
Base excision repair
Nucleotide excision repair
Mismatch repair
Non-homologous end-joining
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:bso03410]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:bso03420]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:bso03430]
Genetic Information Processing; Replication and repair; Non-homologous end-joining [PATH:bso03450]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1415563..1417260)
Genome map
AA seq 565 aa AA seqDB search
MELSSTFPEITQFAKTAFQHLEKELPLTLDGEIVCLVNPCRADFEHLQVRGRLKRPDKIQ
ESANARPCCFLAFDLLERSGEDVTLLSYLDRKKSLRELISAAKLPASPDPYAKETIQSIP
CYDHFDQLWEMVIKYDGEGIVAKKTNSKWLEKKRSSDWLKYKNFKQAYVCITGFNPNNGF
LTVSVLKNGIMTPIASVSHGMRDEEKSAIREIMEQHGHQTPSGEFKLEPSICAAVQYLTI
LHGTLREVSFIGFEFQMDWTECTYAQVIRHSKPVHPKLQFTSLDKIIFEKNKKTKEDFIQ
YMIEVSDYLLPFLKNRAVTVIRYPHGSRSESFFQKNKPDYAPDFVQSFYDGSHEHIVCED
MSTLLWLCNQLALEFHVPFQTIKSRRPAEIVIDLDPPSRDDFLMAVQAANELKRLLDSFG
ITSYPKLSGNKGIQLYIPLSPEAFTYEETRQFTQLIAEYCTNAFPELFTTERLIKNRHGK
LYLDYLQHAEGKTIICPYSTRGNELGTVAAPLYWHEVQSSLTPALFTIDTVIDRIKKQGC
PFFDFYRNPQDEPLSAILHQLKKKS
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
gtggagctcagcagcaccttccctgaaatcacacaattcgccaaaactgcctttcagcac
ctagaaaaagagcttccgctgacacttgacggtgaaatcgtatgtttggtgaatccctgt
cgtgcagattttgaacaccttcaagtgcgggggcgtttgaaaaggccagacaagattcag
gaatcggcaaacgcgcggccgtgctgctttctcgcctttgatttgttagagcgaagcgga
gaagatgtaacgcttctttcgtatttggaccgcaaaaaatcgctgcgtgaactcatatcc
gcagcaaagcttcctgcatctccagatccttacgcaaaagaaaccattcaatccattccc
tgttatgatcattttgatcaactctgggagatggtaataaaatatgacggagaaggaatt
gtagcgaagaaaacaaacagcaaatggcttgaaaagaagcggtcgtccgattggctcaaa
tataaaaactttaaacaagcttatgtttgcataacagggttcaaccctaacaacgggttt
ctgacggtatcggtgttaaaaaacggaataatgacaccgattgcctctgtctcgcacgga
atgcgcgatgaggaaaaaagcgctatacgcgagattatggaacagcacggacatcaaaca
ccctcaggcgagtttaagcttgaaccttcgatttgtgcagctgttcaatacttaacaatt
ctccatggcacattaagagaggtatcgtttatcggtttcgaattccaaatggactggacc
gaatgcacgtatgcgcaagtcatacgacactccaaaccggttcacccaaagctccagttc
acaagcctggataaaatcatatttgaaaagaataaaaaaacaaaagaagattttattcag
tatatgattgaagtcagtgactacctgctcccatttctgaaaaaccgggctgtcaccgtc
atccgctatccgcatggatctaggagcgaatcatttttccaaaaaaacaaaccggactat
gcgccggattttgttcaatctttctatgatggaagccatgaacatattgtctgtgaggat
atgtctacattgctatggctttgcaaccagcttgctttggagtttcacgttccttttcaa
accattaaaagcaggcgtccggctgagattgtcattgatttagacccgccttcgcgagat
gactttcttatggccgtgcaggccgcaaatgaactgaagcggctgttggattcctttggc
atcacatcgtacccgaagctgtccggcaacaaaggcatccagctttatattcccttgtct
cccgaggcatttacgtatgaagaaacacgccaatttacgcagctgatcgcagagtactgc
accaatgcatttcccgagctctttaccactgaacgcttgattaaaaacagacacggcaaa
ttgtatcttgattatttgcagcatgcagaaggaaaaacgattatctgtccctattcgacg
agaggaaatgagcttgggactgttgcagccccgctctactggcatgaggtgcaatcatct
ttaacacccgctctgtttacaattgatacggtcatcgatcgaattaagaagcagggctgc
ccattttttgatttttaccgcaacccgcaagacgaaccgcttagcgccatattgcatcag
ttgaagaaaaagagctga

DBGET integrated database retrieval system