KEGG   Bacillus subtilis subsp. natto BEST195: BSNT_03936Help
Entry
BSNT_03936        CDS       T02607                                 

Definition
hypothetical protein
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
bso  Bacillus subtilis subsp. natto BEST195
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bso00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    BSNT_03936
  Amino acid metabolism
   00380 Tryptophan metabolism
    BSNT_03936
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BSNT_03936
Enzymes [BR:bso01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     BSNT_03936
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     BSNT_03936
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2531178..2533445)
Genome map
AA seq 755 aa AA seqDB search
MLTDDTPEYKQIQQLKYTRMVLNETLRLYPTAPAFSLYAKEDTVLGGEYPISKGQPVTVL
IPKLHRDQNAWGPDAEDFRPERFEDPSSIPHHAYKPFGNGQRACIGMQFALQEATMVLGL
VLKHFELINHTGYELKIKEALTIKPDDFKITVKPRKTAAINVQRKEQAEIKAETKPKETK
PKHGTPLLVLYGSNLGTAEGIADELASQGRQMGFTAETAPLDDYIGKLPEEGAVVIVTAS
YNGSPPDNAAGFVEWLKELEEGQLKGVSYAVFGCGNRSWASTYQRIPRLIDDMMKAKGAS
RLTEIGEGDAADDFESHRESWENRFWKETMDAFDINEIAQKEDRPSLSIAFLSEATETPV
AKAYGAFEGVVLENRELQTADSTRSTCHIELEIPAGKTYKEGDHIGILPKNSRELVQRVL
SRFGLQSNHVIKVSGSAHMAHLPMDRPIKVADLLSSYVELQEPASRLQLRELASYTVCPP
HQKELEQLVSDDGIYKEQVLAKRLTMLDFLEDYPACEMPFERFLALLPSLKPRYYSISSS
PKVHANIVSMTVGVVKASAWSGRGEYRGVASNYLAELNTGDAAACFIRTPQSGFQMPDEP
ETPMIMVGPGTGIAPFRGFIQARSVLKKEGSTLGEALLYFGCRRPDHDDLYREELDQAEQ
EGLVTIRRCYSRVKNEPKEYVQHLLKQDTQKLMTLIEKGAHIYVCGDGSQMAPDVEKTLR
LAYEAEKGASQEESAEWLQKLQDQRRYVKDVWTGM
NT seq 2268 nt NT seq  +upstreamnt  +downstreamnt
gtgttaacggatgacacgcctgaatataaacaaatccagcagctcaaatacactcggatg
gttttaaatgaaaccctcagactgtatccaacagctccggctttttctctatatgcgaag
gaggatactgttctaggcggggaatatccgatcagcaaagggcagccagtcactgtttta
attccaaaactgcaccgggaccaaaacgcttgggggccggatgcggaagatttccgtccg
gaacggtttgaggatccttcaagtatccctcaccatgcgtataagccgtttggaaacgga
cagcgcgcttgtattggcatgcagtttgctcttcaagaagcgacaatggttctcggtctt
gtattaaagcattttgaattgattaaccatactggctacgaactaaaaatcaaagaagca
ttaacgatcaagccggatgattttaaaattactgtgaaaccgcggaaaacagcggcaatc
aatgtacagagaaaagaacaggcagaaatcaaagcagaaacaaagccaaaagaaaccaaa
cctaaacacggcacacctttactcgttctttacggttcaaaccttgggacagctgaggga
atagccgatgaattggcttctcaaggccgccagatgggctttacagctgaaacggctccg
cttgatgattatatcggcaagctccctgaagaaggggcagtcgtcattgtaacggcttct
tataatgggtcgccgcctgataatgctgccggctttgtagagtggctgaaagagcttgag
gaaggccaattgaaaggtgtttcctatgcggtattcggctgcgggaaccggagctgggcc
agcacgtatcagcggattccccgcctgattgatgacatgatgaaagcaaagggggcatcg
cgtttaacagagattggggaaggtgacgccgccgatgattttgaaagccatcgcgagtct
tgggaaaaccgcttctggaaggaaacgatggacgcatttgatattaacgaaatagcccag
aaagaagacaggccttcattatcgattgcttttctcagtgaagcgacggaaacgccggtt
gctaaagcatatggcgcgtttgaaggggttgtgttagagaatcgagaactccagacagct
gacagcacgcgttcaacctgccatattgaattggaaattccggctggtaaaacatataaa
gaaggcgatcatatcggaatcctgccgaagaacagcagggagcttgttcagcgggttctc
agccgattcggtttgcagtccaatcatgtgataaaagtaagcggaagcgctcatatggct
catctgccgatggatcggccgatcaaagttgcggatttattgtcgtcctatgtagagctg
caggaaccggcatcaaggcttcagcttcgggagctggcctcttatacagtttgtccgccg
catcaaaaagagctggaacagctcgtttcagatgatggcatttacaaagagcaggtactt
gcaaaacgtcttaccatgcttgattttttagaggattatcctgcttgcgaaatgccgttt
gaacggtttttagcacttttgccatcactaaaaccgagatactattccatttcaagctca
ccgaaagttcatgcaaatatcgtgagcatgacggtaggagttgtgaaagcctcagcatgg
agcggccgaggtgaataccggggtgtcgcctctaattatttagcagagttgaatacaggt
gatgcagcagcctgcttcattcgtacgccgcagtccggattccagatgccggatgagcct
gaaacgcctatgattatggtcgggccgggcacaggaattgcgccattcaggggctttatt
caggcaagatcggttttgaagaaggaaggaagcacccttggtgaagcacttttatacttc
ggctgccgccgcccggaccatgacgacctttacagagaagagctggatcaagcggaacag
gaaggtttggtcacaatccgccgatgctactcgcgcgtcaaaaacgaaccaaaagaatat
gtccagcacttgctcaagcaagatacgcagaaattgatgacactcattgaaaaaggggct
catatttacgtatgcggtgatggatcacaaatggctcctgatgtagagaagactttgcga
ttggcgtatgaagctgaaaaaggagcaagtcaggaagaatcagctgaatggctgcaaaag
ctgcaagatcaaagacgttatgtgaaagacgtttggacaggaatgtaa

DBGET integrated database retrieval system