KEGG   Bacillus subtilis subsp. natto BEST195: BSNT_03936Help
Entry
BSNT_03936        CDS       T02607                                 

Definition
hypothetical protein
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
bso  Bacillus subtilis subsp. natto BEST195
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Class
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:bso00071]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:bso00380]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:bso00627]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2531178..2533445)
Genome map
AA seq 755 aa AA seqDB search
MLTDDTPEYKQIQQLKYTRMVLNETLRLYPTAPAFSLYAKEDTVLGGEYPISKGQPVTVL
IPKLHRDQNAWGPDAEDFRPERFEDPSSIPHHAYKPFGNGQRACIGMQFALQEATMVLGL
VLKHFELINHTGYELKIKEALTIKPDDFKITVKPRKTAAINVQRKEQAEIKAETKPKETK
PKHGTPLLVLYGSNLGTAEGIADELASQGRQMGFTAETAPLDDYIGKLPEEGAVVIVTAS
YNGSPPDNAAGFVEWLKELEEGQLKGVSYAVFGCGNRSWASTYQRIPRLIDDMMKAKGAS
RLTEIGEGDAADDFESHRESWENRFWKETMDAFDINEIAQKEDRPSLSIAFLSEATETPV
AKAYGAFEGVVLENRELQTADSTRSTCHIELEIPAGKTYKEGDHIGILPKNSRELVQRVL
SRFGLQSNHVIKVSGSAHMAHLPMDRPIKVADLLSSYVELQEPASRLQLRELASYTVCPP
HQKELEQLVSDDGIYKEQVLAKRLTMLDFLEDYPACEMPFERFLALLPSLKPRYYSISSS
PKVHANIVSMTVGVVKASAWSGRGEYRGVASNYLAELNTGDAAACFIRTPQSGFQMPDEP
ETPMIMVGPGTGIAPFRGFIQARSVLKKEGSTLGEALLYFGCRRPDHDDLYREELDQAEQ
EGLVTIRRCYSRVKNEPKEYVQHLLKQDTQKLMTLIEKGAHIYVCGDGSQMAPDVEKTLR
LAYEAEKGASQEESAEWLQKLQDQRRYVKDVWTGM
NT seq 2268 nt NT seq  +upstreamnt  +downstreamnt
gtgttaacggatgacacgcctgaatataaacaaatccagcagctcaaatacactcggatg
gttttaaatgaaaccctcagactgtatccaacagctccggctttttctctatatgcgaag
gaggatactgttctaggcggggaatatccgatcagcaaagggcagccagtcactgtttta
attccaaaactgcaccgggaccaaaacgcttgggggccggatgcggaagatttccgtccg
gaacggtttgaggatccttcaagtatccctcaccatgcgtataagccgtttggaaacgga
cagcgcgcttgtattggcatgcagtttgctcttcaagaagcgacaatggttctcggtctt
gtattaaagcattttgaattgattaaccatactggctacgaactaaaaatcaaagaagca
ttaacgatcaagccggatgattttaaaattactgtgaaaccgcggaaaacagcggcaatc
aatgtacagagaaaagaacaggcagaaatcaaagcagaaacaaagccaaaagaaaccaaa
cctaaacacggcacacctttactcgttctttacggttcaaaccttgggacagctgaggga
atagccgatgaattggcttctcaaggccgccagatgggctttacagctgaaacggctccg
cttgatgattatatcggcaagctccctgaagaaggggcagtcgtcattgtaacggcttct
tataatgggtcgccgcctgataatgctgccggctttgtagagtggctgaaagagcttgag
gaaggccaattgaaaggtgtttcctatgcggtattcggctgcgggaaccggagctgggcc
agcacgtatcagcggattccccgcctgattgatgacatgatgaaagcaaagggggcatcg
cgtttaacagagattggggaaggtgacgccgccgatgattttgaaagccatcgcgagtct
tgggaaaaccgcttctggaaggaaacgatggacgcatttgatattaacgaaatagcccag
aaagaagacaggccttcattatcgattgcttttctcagtgaagcgacggaaacgccggtt
gctaaagcatatggcgcgtttgaaggggttgtgttagagaatcgagaactccagacagct
gacagcacgcgttcaacctgccatattgaattggaaattccggctggtaaaacatataaa
gaaggcgatcatatcggaatcctgccgaagaacagcagggagcttgttcagcgggttctc
agccgattcggtttgcagtccaatcatgtgataaaagtaagcggaagcgctcatatggct
catctgccgatggatcggccgatcaaagttgcggatttattgtcgtcctatgtagagctg
caggaaccggcatcaaggcttcagcttcgggagctggcctcttatacagtttgtccgccg
catcaaaaagagctggaacagctcgtttcagatgatggcatttacaaagagcaggtactt
gcaaaacgtcttaccatgcttgattttttagaggattatcctgcttgcgaaatgccgttt
gaacggtttttagcacttttgccatcactaaaaccgagatactattccatttcaagctca
ccgaaagttcatgcaaatatcgtgagcatgacggtaggagttgtgaaagcctcagcatgg
agcggccgaggtgaataccggggtgtcgcctctaattatttagcagagttgaatacaggt
gatgcagcagcctgcttcattcgtacgccgcagtccggattccagatgccggatgagcct
gaaacgcctatgattatggtcgggccgggcacaggaattgcgccattcaggggctttatt
caggcaagatcggttttgaagaaggaaggaagcacccttggtgaagcacttttatacttc
ggctgccgccgcccggaccatgacgacctttacagagaagagctggatcaagcggaacag
gaaggtttggtcacaatccgccgatgctactcgcgcgtcaaaaacgaaccaaaagaatat
gtccagcacttgctcaagcaagatacgcagaaattgatgacactcattgaaaaaggggct
catatttacgtatgcggtgatggatcacaaatggctcctgatgtagagaagactttgcga
ttggcgtatgaagctgaaaaaggagcaagtcaggaagaatcagctgaatggctgcaaaag
ctgcaagatcaaagacgttatgtgaaagacgtttggacaggaatgtaa

DBGET integrated database retrieval system