KEGG   Bacillus subtilis subsp. natto BEST195: BSNT_04206Help
Entry
BSNT_04206        CDS       T02607                                 

Gene name
ysdC
Definition
hypothetical protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
bso  Bacillus subtilis subsp. natto BEST195
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:bso00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2722997..2724082)
Genome map
AA seq 361 aa AA seqDB search
MAKLDETLTMLKDLTDAKGIPGNEREVRQVMKSYIEPFADEVTTDRLGSLIAKKTGAENG
PKIMIAGHLDEVGFMVTQITDKGFIRFQTVGGWWAQVMLAQRVTIVTKKGEITGVIGSKP
PHILSPEARKKSVEIKDMFIDIGASSREEALEWGILPGDMIVPHFEFTVMNNEKFLLAKA
WDNRIGCAIAIDVLRNLQNTDHPNIVYGVGTVQEEVGLRGAKTAAHTIQPDIAFGVDVGI
AGDTPGISEKEAQSKMGKGPQIIVYDASMVSHKGLRDAVVATAEEAGIPYQFDAIAGGGT
DSGAIHLTANGVPALSITIATRYIHTHAAMLHRDDYENAVKLITEVIKKLDRKTVDEITY
Q
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaattagatgaaacattgaccatgctgaaagatttaacagatgcaaaaggcata
ccgggcaatgaaagagaagtaaggcaagtgatgaaatcatacatagaaccatttgctgat
gaggtgacaacagatcgcctgggcagtttaattgccaaaaaaactggtgcagaaaacggc
ccgaaaattatgatcgccggacatttggatgaagtcggctttatggtgacacaaatcaca
gataaaggctttatccgttttcaaaccgttggcggctggtgggctcaggttatgcttgcc
cagcgcgtcaccatcgtcacaaaaaaaggagaaatcactggggttatcggctctaagccg
ccgcatattttatctcctgaagcaagaaaaaaatcagtggaaataaaagacatgtttatt
gatattggagcttcaagccgggaagaagccttggagtggggtatactcccgggagatatg
atcgttccgcattttgaatttacggtcatgaacaatgaaaaattcctactcgcaaaggcg
tgggacaaccgcattggctgtgcgattgcaattgatgtgttaagaaacttacaaaacaca
gatcatccaaatatagtgtatggcgtcggaaccgtgcaggaggaagtcggcctgagggga
gcgaaaacggctgcacacaccattcagcctgatattgcgtttggtgttgatgtagggata
gcaggagacacgcctggcatttccgagaaagaagcgcagagcaaaatgggcaaaggcccg
cagattatcgtttacgatgcatccatggtctctcacaaaggtttgcgcgatgcagttgta
gccactgcggaggaagccggcattccgtaccaatttgatgccattgccggcggcggaact
gattctggtgccatccatttgacggcgaatggtgttcctgcgctgtccattaccattgca
acccgctacattcatacgcacgcggccatgctgcatcgtgatgattatgaaaacgcggta
aagttaattacagaagtcattaagaagttagaccgaaaaacggttgacgaaattacgtac
caataa

DBGET integrated database retrieval system