KEGG   Bacillus subtilis subsp. natto BEST195: BSNT_05093Help
Entry
BSNT_05093        CDS       T02607                                 

Gene name
yvaK
Definition
hypothetical protein
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
bso  Bacillus subtilis subsp. natto BEST195
Brite
Enzymes [BR:bso01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     BSNT_05093 (yvaK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3286805..3287545)
Genome map
AA seq 246 aa AA seqDB search
MKVVTPKPFTFKGGDKAVLLLHGFTGNTADVRMLGRYLNERGYTCHAPQYEGHGVPPEEL
VHTGPEDWWKNVMDGYEYLKSEGYESIAACGLSLGGVFSLKLGYTVPIKGIVPMCAPMHI
KSEEVMYQGVLSYARNYKKFEGKSPEQIEEEMKEFEKTPMNTLKALQDLIADVRNNVDMI
YSPTFVVQARHDHMINTESANIIYNEVETDDKQLKWYEESGHVITLDKERDLVHQDVYEF
LEKLDW
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttgtgacaccaaaaccatttacatttaaaggcggagacaaagcggtgcttttg
ctgcatggctttacaggaaatacagcggatgtaaggatgctgggacgatatttgaatgaa
cgcggctatacgtgccacgcgcctcaatatgaaggacatggcgtcccgcctgaagaactt
gtacatacggggcccgaagactggtggaaaaacgtaatggatggctatgaatacttaaaa
tctgaaggctatgagagcattgctgcctgcggactgtcgcttggcggggttttttcgctg
aaattgggttacactgtacccataaagggaattgtcccaatgtgcgcaccgatgcatatt
aagagtgaagaggttatgtatcaaggcgttctttcatacgctcgcaattacaaaaagttt
gaggggaaaagcccggagcaaattgaagaggaaatgaaagaattcgaaaaaacgccgatg
aataccctcaaggcactgcaagacttaattgctgatgtgcggaataatgtcgatatgatt
tattcaccgacatttgtggtgcaggcccgtcatgaccacatgattaataccgaaagcgcc
aatattatttacaacgaagtggaaactgatgataaacagctgaaatggtacgaggaatca
gggcatgtcattacactcgacaaagaacgtgacctcgtccatcaggatgtgtatgaattt
ttagagaagctcgattggtaa

DBGET integrated database retrieval system