KEGG   Bacillus subtilis subsp. natto BEST195: BSNT_05475Help
Entry
BSNT_05475        CDS       T02607                                 

Gene name
rbsK
Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
bso  Bacillus subtilis subsp. natto BEST195
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:bso00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BSNT_05475 (rbsK)
Enzymes [BR:bso01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     BSNT_05475 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3565036..3565884
Genome map
AA seq 282 aa AA seqDB search
MDLVVTSDKRPKAGETVLGTSFQTVPGGKGANQAVAAARLGAQVFMVGKVGDDHYGTAIL
NNLKANGVCTDYMEPVTHTESGTAHIVLAEGDNSIVVVKGANDDITPAYALKALEQIEKV
DMVLIQQEIPEETVDEVCKYCHSLDIPIMLNPAPARPLKQETIDHATYLTPNEHESSILF
PDLTTSEALALYPAKLFITEGKQGVRYSAGSKEVLIPSFPVEPVDTTGAGDTFNAAFAVA
LAEGKDIEAALRFANRAASLSVCSFGAQGGMPTRNEVEELLS
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atggatttagtagtcacctcggacaaacgcccaaaagccggtgaaacggttcttggcacg
tcatttcagactgtgccgggcggcaaaggagcaaatcaggccgttgccgcagcaagactt
ggggcgcaagtgtttatggtcggcaaggttggagacgatcattatggaacagctatattg
aataatctcaaagctaacggcgtttgcactgactatatggaaccggttacacatacggaa
agcggaaccgctcatattgtgcttgctgaaggtgacaacagcattgtcgttgtcaaaggc
gcgaacgatgacatcaccccagcgtatgcgttaaaagcgcttgaacagattgaaaaggtc
gatatggtgctgattcagcaggaaatcccagaagaaacggttgatgaggtgtgcaaatac
tgccattctctcgatatcccgatcatgctaaacccggcaccggcccgcccgctcaagcag
gaaaccattgatcacgccacctatctgacgccgaatgaacacgagtcttcgattttattc
cctgatcttaccacttctgaagctctggcgctttatccggcaaagctctttattacggaa
ggaaaacaaggcgtccgctattcggctggcagcaaagaagtgctcatcccgtccttccct
gttgagcccgttgatacaaccggagccggtgatacgtttaacgcagcatttgccgtggcc
ctggctgagggaaaagatattgaagccgcattgcggtttgccaatcgagcggcttccctt
tctgtctgttccttcggtgcccaaggcggaatgccgacaagaaatgaagtagaggagctg
ctgtcatga

DBGET integrated database retrieval system