KEGG   Bacillus subtilis subsp. natto BEST195: BSNT_05658Help
Entry
BSNT_05658        CDS       T02607                                 

Gene name
tdk
Definition
thymidine kinase
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
bso  Bacillus subtilis subsp. natto BEST195
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bso00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    BSNT_05658 (tdk)
Enzymes [BR:bso01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     BSNT_05658 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3667159..3667746)
Genome map
AA seq 195 aa AA seqDB search
MYIMKQSGWLELICGSMFSGKSEELIRRVKRATYAKQEVRVFKPVIDNRYSEAAVVSHNG
TSMTSYAISSAADIWDHISESTDVIAVDEVQFFDQEIVEVLSSLADKGYRVIAAGLDMDF
RGEPFGVVPNIMAIAESVTKLQAVCSVCGSPASRTQRLIDGKPASYDDPVILVGASESYE
ARCRHHHEVPGKSKK
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgtacataatgaaacaaagcgggtggcttgagctgatttgcggcagcatgttctcgggg
aaatctgaagagctgatcagaagagtgaagagagcaacttatgccaagcaggaagtcagg
gtatttaagcctgtaattgataaccgatacagcgaagctgctgttgtctcccataatgga
acatcgatgacgagctatgccatttcgtctgctgcggacatttgggatcacatcagtgaa
agtacagatgtgattgcggttgatgaagtgcagttttttgatcaggaaattgttgaggtt
ttatcatctcttgccgataaaggctaccgtgtgatagcagcaggccttgatatggatttt
aggggagagccgttcggtgtcgtcccgaatatcatggcgattgcggaaagtgtgacaaag
ctgcaagccgtctgttctgtttgcggatcaccggcgagcagaacacagcgcctcattgac
ggcaaacctgcttcttacgatgatccggtcattttggttggtgcatctgaatcatatgaa
gcaagatgcagacatcatcacgaagtcccaggaaaatctaaaaaatag

DBGET integrated database retrieval system