KEGG   Bacillus subtilis PY79: U712_01565Help
Entry
U712_01565        CDS       T02937                                 

Definition
Alpha-amylase (EC:3.2.1.1)
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
bsp  Bacillus subtilis PY79
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsp00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    U712_01565
Enzymes [BR:bsp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     U712_01565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
327623..329602
Genome map
AA seq 659 aa AA seqDB search
MFAKRFKTSLLPLFAGFLLLFHLVLAGPAAASAETANKSNELTAPSIKSGTILHAWNWSF
NTLKHNMKDIHDAGYTAIQTSPINQVKEGNQGDKSMSNWYWLYQPTSYQIGNRYLGTEQE
FKEMCAAAEEYGIKVIVDAVINHTTSDYAAISNEVKSIPNWTHGNTQIKNWSDRWDVTQN
SLLGLYDWNTQNTQVQSYLKRFLDRALNDGADGFRFDAAKHIELPDDGSYGSQFWPNITN
TSAEFQYGEILQDSASRDAAYANYMDVTASNYGHSIRSALKNRNLGVSNISHYASDVSAD
KLVTWVESHDTYANDDEESTWMSDDDIRLGWAVIASRSGSTPLFFSRPEGGGNGVRFPGK
SQIGDRGSALFEDQAITAVNRFHNVMAGQPEELSNPNGNNQIFMNQRGSHGVVLANAGSS
SVSINTATKLPDGRYDNKAGAGSFQVNDGKLTGTINARSVAVLYPDDIAKAPHVFLENYK
TGVTHSFNDQLTITLRADANTTKAVYQINNGPETAFKDGDQFTIGKGDPFGKTYTIMLKG
TNSDGVTRTEKYSFVKRDPASAKTIGYQNPNHWSQVNAYIYKHDGSRVIELTGSWPGKPM
TKNADGIYTLTLPADTDTTNAKVIFNNGSAQVPGQNQPGFDYVLNGLYNDSGLSGSLPH
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atgtttgcaaaacgattcaaaacctctttactgccgttattcgctggatttttattgctg
tttcatttggttctggcaggaccggcggctgcgagtgctgaaacggcgaacaaatcgaat
gagcttacagcaccgtcgatcaaaagcggaaccattcttcatgcatggaattggtcgttc
aatacgttaaaacacaatatgaaggatattcatgatgcaggatatacagccattcagaca
tctccgattaaccaagtaaaggaagggaatcaaggagataaaagcatgtcgaactggtac
tggctgtatcagccgacatcgtatcaaattggcaaccgttacttaggtactgaacaagaa
tttaaagaaatgtgtgcagccgctgaagaatatggcataaaggtcattgttgacgcggtc
atcaatcataccaccagtgattatgccgcgatttccaatgaggttaagagtattccaaac
tggacacatggaaacacacaaattaaaaactggtctgatcgatgggatgtcacgcagaat
tcattgctcgggctgtatgactggaatacacaaaatacacaagtacagtcctatctgaaa
cggttcttagacagggcattgaatgacggggcagacggttttcgatttgatgccgccaaa
catatagagcttccagatgatggcagttacggcagtcaattttggccgaatatcacaaat
acatctgcagagttccaatacggagaaatcctgcaggatagtgcctccagagatgctgca
tatgcgaattatatggatgtgacagcgtctaactatgggcattccataaggtccgcttta
aagaatcgtaatctgggcgtgtcgaatatctcccactatgcatctgatgtgtctgcggac
aagctagtgacatgggtagagtcgcatgatacgtatgccaatgatgatgaagagtcgaca
tggatgagcgatgatgatatccgtttaggctgggcggtgatagcttctcgttcaggcagt
acgcctcttttcttttccagacctgagggaggcggaaatggtgtgaggttcccggggaaa
agccaaataggcgatcgcgggagtgctttatttgaagatcaggctatcactgcggtcaat
agatttcacaatgtgatggctggacagcctgaggaactctcgaacccgaatggaaacaac
cagatatttatgaatcagcgcggctcacatggcgttgtgctggcaaatgcaggttcatcc
tctgtctctatcaatacggcaacaaaattgcctgatggcaggtatgacaataaagctgga
gcgggttcatttcaagtgaacgatggtaaactgacaggcacgatcaatgccaggtctgta
gctgtgctttatcctgatgatattgcaaaagcgcctcatgttttccttgagaattacaaa
acaggtgtaacacattctttcaatgatcaactgacgattaccttgcgtgcagatgcgaat
acaacaaaagccgtttatcaaatcaataatggaccagagacggcgtttaaggatggagat
caattcacaatcggaaaaggagatccatttggcaaaacatacaccatcatgttaaaagga
acgaacagtgatggtgtaacgaggaccgagaaatacagttttgttaaaagagatccagcg
tcggccaaaaccatcggctatcaaaatccgaatcattggagccaggtaaatgcttatatc
tataaacatgatgggagccgagtaattgaattgaccggatcttggcctggaaaaccaatg
actaaaaatgcagacggaatttacacgctgacgctgcctgcggacacggatacaaccaac
gcaaaagtgatttttaataatggcagcgcccaagtgcccggtcagaatcagcctggcttt
gattacgtgctaaatggtttatataatgactcgggcttaagcggttctcttccccattga

DBGET integrated database retrieval system