KEGG   Bacillus subtilis PY79: U712_05170Help
Entry
U712_05170        CDS       T02937                                 

Definition
Protoporphyrinogen oxidase (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
bsp  Bacillus subtilis PY79
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bsp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    U712_05170
Enzymes [BR:bsp01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     U712_05170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
1051231..1052643
Genome map
AA seq 470 aa AA seqDB search
MSDGKKHVVIIGGGITGLAAAFYMEKEIKEKNLPLELTLVEASPRVGGKIQTVKKDGYII
ERGPDSFLERKKSAPQLVKDLGLEHLLVNNATGQSYVLVNRTLHPMPKGAVMGIPTKIAP
FVSTGLFSLSGKARAAMDFILPASKTKDDQSLGEFFRRRVGDEVVENLIEPLLSGIYAGD
IDKLSLMSTFPQFYQTEQKHRSLILGMKKTRPQGSGQQLTAKKQGQFQTLSTGLQTLVEE
IEKQLKLTKVYKGTKVTKLSHSGSCYSLELDNGVTLDADSVIVTAPHKAAAGMLSELPAI
SHLKNMHSTSVANVALGFPEGSVQMEHEGTGFVISRNSDFAITACTWTNKKWPHAAPEGK
TLLRAYVGKAGDESIVDLSDNDIINIVLEDLKKVMNINGEPEMTCVTRWHESMPQYHVGH
KQRIKELREALASAYPGVYMTGASFEGVGIPDCIDQGKAAVSDALTYLFS
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacggcaaaaaacatgtagtcatcatcggcggcggcattaccggtttagccgcc
gccttctatatggaaaaagaaatcaaagaaaagaatctgccgcttgagctgacacttgtt
gaggcaagtccgagagtcggcgggaaaatccagactgtcaagaaagacggctatatcatc
gaaagagggccagactcatttctggaacgaaagaaaagcgccccgcagcttgttaaagac
ttaggtcttgagcatttgcttgtcaacaatgcgaccgggcaatcctatgtgcttgtaaac
cgcaccctgcatccaatgccgaagggcgctgtaatggggataccgacaaaaattgcgccg
tttgtttctacgggtctgttttccttgtccgggaaggcgagagctgctatggatttcatc
ctgcctgcaagcaaaacaaaggatgatcagtcattgggagaattcttccgcagacgtgtc
ggagatgaagtggtcgagaacttaatcgagccgctactatcagggatctacgcaggcgac
attgacaagctcagcctgatgtcgacatttccgcaattttatcagacggaacaaaagcat
agaagcctgattctcggcatgaaaaaaacaaggcctcaaggctcaggccagcagctgacg
gcaaaaaaacaagggcagttccaaactctgtcaaccggtttgcagacccttgtagaagag
atcgaaaagcagttaaagctgacgaaggtgtataaaggcacaaaagtgaccaaacttagc
catagcggctcttgctattcgctcgaactggataacggcgtcacacttgatgctgattca
gtaattgtgactgctccgcataaagcggctgcgggaatgctttctgagcttcctgccatt
tctcatttgaaaaatatgcactccacatccgtggcaaacgtcgctttaggtttccctgaa
ggctccgtccaaatggagcatgagggcacgggttttgtcatttcaagaaacagtgacttt
gcgatcacagcctgtacgtggacgaataaaaaatggccgcacgcagcgccggaaggcaaa
acgctgcttcgggcatatgtcggaaaagccggagacgaatccattgtcgatctatcagat
aatgacattatcaacattgtgttagaagacttaaagaaagtcatgaacataaacggcgag
ccggaaatgacatgtgtaacccgatggcatgaaagcatgccgcagtaccatgtcggccat
aagcagcgtatcaaggagctgcgtgaagcacttgcatctgcgtatccgggtgtttatatg
acaggcgcttctttcgaaggtgtcggcattcccgactgcattgatcaaggaaaagctgcc
gtgtctgacgcgcttacctatttattcagctaa

DBGET integrated database retrieval system