KEGG   Bacillus subtilis PY79: U712_09240Help
Entry
U712_09240        CDS       T02937                                 

Definition
Xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
bsp  Bacillus subtilis PY79
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsp00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    U712_09240
   00051 Fructose and mannose metabolism
    U712_09240
Enzymes [BR:bsp01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     U712_09240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1854946..1856283
Genome map
AA seq 445 aa AA seqDB search
MAQSHSSSINYFGSANKVVYEGKDSTNPLAFKYYNPQEVIGGKTLKEHLRFSIAYWHTFT
ADGTDVFGAATMQRPWDHYKGMDLAKMRVEAAFEMFEKLDAPFFAFHDRDIAPEGSTLKE
TNQNLDMIMGMIKDYMRNSGVKLLWNTANMFTNPRFVHGAATSCNADVFAYAAAQVKKGL
ETAKELGAENYVFWGGREGYETLLNTDLKFELDNLARFMHMAVDYAKEIGYTGQFLIEPK
PKEPTTHQYDTDAATTIAFLKQYGLDNHFKLNLEANHATLAGHTFEHELRMARVHGLLGS
VDANQGHPLLGWDTDEFPTDLYSTTLAMYEILQNGGLGSGGLNFDAKVRRSSFEPDDLIY
AHIAGMDAFARGLKVAHKLIEDRVFEDVIQHRYRSFTEGIGLEIIEGRANFHTLEQYALN
HKSIKNESGRQEKLKAILNQYILEV
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atggctcaatctcattccagttcaatcaactattttggaagcgcaaacaaagtggtttac
gaagggaaagattcgactaatcctttagcatttaaatattataatcctcaagaagtaatc
ggcggaaaaacgctgaaagagcatttgcgattttctattgcctattggcatacatttact
gctgatggtacagacgtttttggagcagctacgatgcaaagaccatgggatcactataaa
ggcatggatctagcgaagatgagagtagaagcagcatttgagatgtttgaaaaactagat
gcaccattctttgcttttcatgaccgggatattgcaccagaaggcagtacgctaaaagag
acaaaccaaaatttagatatgatcatgggcatgattaaagattacatgagaaatagcggc
gttaagctattatggaatacagcaaacatgtttacgaatccccgtttcgtccatggtgcc
gcgacttcttgcaatgcagatgtgtttgcgtatgctgcagcacaagtgaaaaaagggtta
gaaacagcaaaagagcttggcgctgagaactatgtattttggggcggccgtgaaggatat
gaaacattgttaaataccgatttaaaatttgagcttgataatttggctagatttatgcat
atggcagtggattatgcgaaggaaatcgggtacacagggcagtttttgattgagccaaaa
ccaaaagagccgaccacccatcaatacgatacagatgcagcaacaaccattgcctttttg
aagcaatatggcttagacaatcattttaaattaaatcttgaagccaatcatgccacatta
gccgggcatacattcgaacatgaattacgcatggcaagagtacatggtctgcttggctct
gttgacgcaaaccagggtcatcctcttttaggctgggacacggatgaatttccgacggat
ttatattctacgacattagcaatgtacgaaatcctgcaaaatggcggccttggaagcggc
ggattaaactttgacgcgaaggtcagaagatcttctttcgagcctgatgatctaatatat
gcccatattgcagggatggatgcatttgcaagaggattgaaagttgcccacaaattaatc
gaagatcgtgtgtttgaagatgtgattcaacatcgttaccgcagctttactgaagggatt
ggtcttgaaattatagaaggaagagctaatttccacacacttgagcaatatgcgctaaat
cataaatcaattaaaaacgaatctggaagacaggagaaattaaaagcgatattgaaccaa
tacattttagaagtataa

DBGET integrated database retrieval system