KEGG   Bacillus subtilis PY79: U712_10020Help
Entry
U712_10020        CDS       T02937                                 

Definition
Putative L-amino-acid oxidase YobN (EC:1.13.12.3)
Orthology
K00274  
monoamine oxidase [EC:1.4.3.4]
Organism
bsp  Bacillus subtilis PY79
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:bsp00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    U712_10020
   00330 Arginine and proline metabolism
    U712_10020
   00340 Histidine metabolism
    U712_10020
   00350 Tyrosine metabolism
    U712_10020
   00360 Phenylalanine metabolism
    U712_10020
   00380 Tryptophan metabolism
    U712_10020
Enzymes [BR:bsp01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.4  monoamine oxidase
     U712_10020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2026694..2028034
Genome map
AA seq 446 aa AA seqDB search
MSGLVSASLLKNAGHRVTILEASGRAGGRVCTLRSPFSDDLYFNAGPMRIPNNHSLTLEY
IKKFKLPTNVFINRTPMDIIYANGIKTRLQVFERAPGILRYPVAPNEQGKTSEELMLSLL
QPILNFINQNPARNWRIVEEQYKNHSLSSFLNTYFSYGAIDMIGVLLDMEAYMGMSLVEV
LRESIFFSSPAHFYEITGGMDLLPHAFLPQLKTNILYHQKMMKMSQGENRVTIHCQHQQT
AEFTSFTADLAIVTIPFSTLRFVKVEPYHSFSYYKRRAIRELNYISATKIGIEFKSRFWE
KAGQHGGKSITDLPIRFSYYPSRNIGANGHAVILASYTWADEALIWDSLSEGERIQYTLL
NLSEIYGDIVWSEFVSGTSFSWSQYPYSAGGFTAFEPGQELELYPYIPVPEGRVHFAGEH
ASLTHAWMQGAIESGIRVAYEVNRLP
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
ttgtccgggcttgtatcagcatctttgttgaaaaatgccggtcacagagtaacgattctc
gaagcgagcggcagagcgggcggccgtgtctgcactttgagatctccctttagtgatgat
ttgtatttcaacgctggcccgatgcgcataccgaataaccattcgttaaccttagaatat
atcaaaaaattcaaattgccaacaaatgtatttatcaacagaaccccgatggacatcatt
tatgcaaatggaatcaaaacacgtctccaagtttttgaacgagctcctggaatattgaga
tatccagttgcaccaaatgaacaagggaaaacgtctgaagagctgatgctttctttactg
cagcctattctaaattttatcaatcaaaatccagcaagaaattggcggattgtcgaagaa
caatacaaaaatcattcgttaagctcttttttaaacacgtatttttcatatggcgcgatc
gatatgatcggtgtacttttggatatggaagcgtatatggggatgtcccttgttgaagta
ttgcgggaatctatctttttttcatcccccgctcacttctatgagataactggcggtatg
gatctgctgcctcacgcgtttcttcctcaattaaaaacaaacattctataccatcaaaaa
atgatgaaaatgtctcagggtgaaaatcgtgttacgatccattgtcagcatcaacaaacg
gcagaattcacatcattcacagctgatctcgctattgtaaccattcctttttcaacattg
cgatttgtaaaagtcgaaccataccattcattctcttactataaacggagggccatccgt
gagctaaactatatcagtgcaacaaaaatcggcatagagtttaaaagccgattttgggaa
aaagccggtcagcacggcggcaaatctattactgatcttccgattcgtttttcatattat
ccaagcagaaatattggagcaaatggacatgctgtcattctggccagctatacatgggcc
gatgaggcactgatatgggacagtctttcagaaggagagcgaatccagtatactttactg
aatttatctgaaatctatggtgatattgtgtggtctgaatttgtgtctggcacttctttt
agctggagccagtacccgtattctgcgggaggttttacagctttcgaaccaggacaagaa
ttagagctgtatccctatattcctgtccctgagggcagagttcatttcgccggagaacac
gcctcactcactcatgcgtggatgcaaggcgcgattgaatctggaatacgtgttgcttat
gaggtcaatcgcttaccttag

DBGET integrated database retrieval system