KEGG   Bacillus subtilis PY79: U712_13335Help
Entry
U712_13335        CDS       T02937                                 

Definition
putative bifunctional P450/NADPH P450 reductase 2
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
bsp  Bacillus subtilis PY79
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Class
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:bsp00071]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:bsp00380]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:bsp00627]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2591744..2594908)
Genome map
AA seq 1054 aa AA seqDB search
MKQASAIPQPKTYGPLKNLPHLEKEQLSQSLWRIADELGPIFRFDFPGVSSVFVSGHNLV
AEVCDEKRFDKNLGKGLQKVREFGGDGLFTSWTHEPNWQKAHRILLPSFSQKAMKGYHSM
MLDIATQLIQKWSRLNPNEEIDVADDMTRLTLDTIGLCGFNYRFNSFYRDSQHPFITSML
RALKEAMNQSKRLGLQDKMMVKTKLQFQKDIEVMNSLVDRMIAERKANPDENIKDLLSLM
LYAKDPVTGETLDDENIRYQIITFLIAGHETTSGLLSFAIYCLLTHPEKLKKAQEEADRV
LTDDTPEYKQIQQLKYIRMVLNETLRLYPTAPAFSLYAKEDTVLGGEYPISKGQPVTVLI
PKLHRDQNAWGPDAEDFRPERFEDPSSIPHHAYKPFGNGQRACIGMQFALQEATMVLGLV
LKHFELINHTGYELKIKEALTIKPDDFKITVKPRKTAAINVQRKEQADIKAETKPKETKP
KHGTPLLVLFGSNLGTAEGIAGELAAQGRQMGFTAETAPLDDYIGKLPEEGAVVIVTASY
NGAPPDNAAGFVEWLKELEEGQLKGVSYAVFGCGNRSWASTYQRIPRLIDDMMKAKGASR
LTAIGEGDAADDFESHRESWENRFWKETMDAFDINEIAQKEDRPSLSITFLSEATETPVA
KAYGAFEGIVLENRELQTAASTRSTRHIELEIPAGKTYKEGDHIGILPKNSRELVQRVLS
RFGLQSNHVIKVSGSAHMAHLPMDRPIKVVDLLSSYVELQEPASRLQLRELASYTVCPPH
QKELEQLVSDDGIYKEQVLAKRLTMLDFLEDYPACEMPFERFLALLPSLKPRYYSISSSP
KVHANIVSMTVGVVKASAWSGRGEYRGVASNYLAELNTGDAAACFIRTPQSGFQMPNDPE
TPMIMVGPGTGIAPFRGFIQARSVLKKEGSTLGEALLYFGCRRPDHDDLYREELDQAEQD
GLVTIRRCYSRVENEPKGYVQHLLKQDTQKLMTLIEKGAHIYVCGDGSQMAPDVERTLRL
AYEAEKAASQEESAVWLQKLQDQRRYVKDVWTGM
NT seq 3165 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaggcaagcgcaatacctcagcccaaaacatacggacctttaaaaaatcttccg
catctggaaaaagaacagctttctcaatccttatggcggatagctgatgaattgggaccg
attttccgttttgattttccgggagtatccagtgtttttgtgtccggccacaatcttgtg
gctgaagtgtgtgatgaaaaacgctttgacaagaaccttggcaaaggcttgcaaaaggtg
cgtgagttcgggggagatggcttatttacaagctggacgcacgaaccgaactggcaaaaa
gcccaccgcattttgctgccgagttttagtcaaaaagcgatgaaaggctatcattctatg
atgctggatatcgcaacccagctgattcaaaagtggagccggttaaaccctaatgaagaa
attgatgtagcggacgatatgacacgtctgacgcttgatacgattgggttatgcgggttt
aactatcgattcaacagcttttaccgtgattcacagcatccgtttatcaccagtatgctc
cgtgccttaaaagaggcgatgaatcaatcgaaaagactgggcctgcaagataaaatgatg
gtgaaaacgaagctgcagttccaaaaggatatagaagtcatgaactccctggttgataga
atgatagcggagcgaaaggcgaatccggatgaaaacattaaggatctcttgtctctcatg
ctttatgccaaagatccagtaacgggtgaaacgctggatgacgaaaacattcgataccaa
atcatcacatttttaattgctggacatgagacaacaagcgggttgctatcctttgcgatt
tattgtctgcttacacatccggaaaaactgaaaaaagctcaggaggaagcggatcgcgtg
ttaacggatgacacgcctgaatataaacaaatccagcagctcaaatacattcggatggtt
ttaaatgaaaccctcagactgtatccaacagctccggctttttctctatatgcgaaggag
gatactgttctaggcggggaatatccgatcagcaaagggcagccagtcactgttttaatt
ccaaaactgcaccgggatcaaaacgcttggggaccggatgcggaagatttccgtccggaa
cggtttgaggatccttcaagtatccctcaccatgcgtataagccgtttggaaacggacag
cgcgcttgtattggcatgcagtttgctcttcaagaagcgacaatggttctcggtcttgta
ttaaagcattttgaattgataaaccatactggctacgaactaaaaatcaaagaagcatta
acgatcaagccggatgattttaaaattactgtgaaaccgcgaaaaacagcggcaatcaat
gtacagagaaaagaacaggcagacatcaaagcagaaacaaagccaaaagaaaccaaacct
aaacacggcacacctttacttgttctttttggttcaaatcttgggacagctgagggaata
gccggtgaactggctgctcaaggccgccagatgggctttacagctgaaacggctccgctt
gatgattatatcggcaagctccctgaagaaggggcagtcgtcattgtaacggcttcttat
aatggggcgccgcctgataatgctgccggatttgtagagtggctgaaagagcttgaggaa
ggccaattgaaaggtgtttcctatgcggtattcggctgcggaaaccggagctgggccagc
acgtatcagcggattccccgcctgattgatgacatgatgaaagcaaagggggcatcgcgt
ttaacagcgattggggaaggtgacgccgccgatgattttgaaagccaccgcgagtcttgg
gaaaaccgcttctggaaggaaacgatggacgcatttgatattaacgaaatagcccagaaa
gaagacaggccttcattatcgattacttttctcagtgaagcgacggaaacgccggttgct
aaagcatatggcgcgtttgaagggattgtgttagagaatcgagaactccagacagctgcc
agcacgcgttcaacccgccatattgaattggaaattccggctggtaaaacatataaagaa
ggcgatcatatcggaatcctgccaaagaacagcagggagcttgttcagcgggttctcagc
cgattcggtttgcagtccaatcatgtgataaaagtaagcggaagcgctcatatggctcat
ctgccgatggatcggccaatcaaagtagtggatttattgtcgtcctatgtagagctgcag
gaaccggcatcaaggcttcagcttcgggagctggcctcttatacagtttgtccgccgcat
caaaaagagctggaacagctcgtttcagatgatggcatttacaaagagcaggtacttgca
aaacgtcttaccatgcttgattttttagaggattatcctgcttgcgaaatgccgtttgaa
cggtttttagcacttttgccatcactaaaaccgagatactattccatttcaagctcaccg
aaagttcatgcaaatatcgtgagcatgacggtaggagttgtgaaagcctcagcatggagc
ggccgaggtgaataccggggtgtcgcctctaattatttagcagaattgaatacaggtgat
gcagcagcttgcttcattcgtacgccgcagtccggatttcagatgccgaatgatcctgaa
acgcctatgattatggtcgggccgggcacaggaattgcgccattcagaggctttattcag
gcaagatcggttttgaagaaggaaggaagcacccttggtgaagcacttttatacttcggc
tgccgccgcccggaccatgacgacctttacagagaagagctggatcaagcggaacaggac
ggtttggtcacaatccgccgatgctactcgcgcgtcgaaaacgaaccaaaaggatatgtc
cagcacttgctcaagcaagatacgcagaaattgatgacactcattgaaaaaggggctcat
atttacgtatgcggtgatggatcgcaaatggctcctgatgtagagagaactttgcgattg
gcatatgaagctgaaaaagcagcaagtcaggaagaatcagctgtatggctgcaaaagctg
caagatcaaagacgttatgtgaaagacgtttggacaggaatgtaa

DBGET integrated database retrieval system