KEGG   Bacillus subtilis PY79: U712_15390Help
Entry
U712_15390        CDS       T02937                                 

Definition
1,4-alpha-glucan-branching enzyme (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
bsp  Bacillus subtilis PY79
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bsp00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    U712_15390
Enzymes [BR:bsp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     U712_15390
Exosome [BR:bsp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   U712_15390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2987618..2989501)
Genome map
AA seq 627 aa AA seqDB search
MAAASPTAHDVYLFHEGSLFKSYQLFGSHYRELNGKSGYEFCVWAPHASEVRVAGDFNSW
SGEEHVMHRVNDNGIWTLFIPGIGEKERYKYEIVTNNGEIRLKADPYAIYSEVRPNTASL
TYDLEGYSWQDQKWQKKQKAKTLYEKPVFIYELHLGSWKKHSDGRHYSYKELSQTLIPYI
KKHGFTHIELLPVYEHPYDRSWGYQGTGYYSPTSRFGPPHDLMKFVDECHQQNIGVILDW
VPGHFCKDAHGLYMFDGEPLYEYKEERDRENWLWGTANFDLGKPEVHSFLISNALYWAEF
YHIDGFRVDAVANILYWPNQDERHTNPYAVDFLKKLNQTMREAYPHVMMIAEDSTEWPQV
TGAVEEGGLGFHYKWNMGWMNDVLKYMETPPEERRHCHQLISFSLLYAFSEHFVLPFSHD
EVVYGKKSLLNKMPGDYWQKFAQYRLLLGYMTVHPGKKLIFMGSEFAQFDEWKDTEQLDW
FLDSFPMHQKASVFTQDLLRFYQKSKILYEHDHRAQSFEWIDVHNDEQSIFSFIRYGQKH
GEALVIICNFTPVVYHQYDVGVPFFTQYIEVLNSDSETYGGSGQINKKPLSAKKGALHHK
PCYITMTIPPYGISILRAVKKRGEIKR
NT seq 1884 nt NT seq  +upstreamnt  +downstreamnt
atggccgctgccagcccgacagcacatgatgtttatctttttcacgaaggcagtctgttt
aaaagctatcagctgtttggctcgcattaccgcgagctgaatggcaaaagcggatatgaa
ttctgtgtgtgggcgcctcatgcgtcggaagtacgagtggctggagattttaacagctgg
tctggagaagagcatgtgatgcacagagtgaatgataatggcatttggacgttatttatt
ccaggtataggagaaaaggaacgatataaatacgaaattgtgacgaataacggtgagatc
aggctgaaggcagatccatacgctatttattcagaagtcagaccaaacacagcgtcactt
acttacgatttggaaggatacagctggcaagatcaaaaatggcaaaagaaacagaaggct
aagacgctgtatgaaaaacctgttttcatttatgaactgcatcttgggtcttggaagaag
cattctgatggcaggcattattcctataaagaattaagtcagacgcttatcccttatatc
aagaagcatgggtttacccatattgaactgcttcccgtgtatgagcatccatatgatcgt
tcatgggggtaccaaggaacggggtattacagcccgacaagcaggtttggcccgccgcat
gatctgatgaagtttgtggatgaatgtcatcaacaaaatatcggagtcattttggattgg
gtccccggacatttttgtaaagatgcacatggcctttatatgtttgatggagaaccgctt
tatgaatacaaagaagaacgtgatcgggagaactggttatggggcacggcaaactttgac
ctggggaaaccggaagttcatagttttttaatttcgaatgcgttgtactgggcggaattc
tatcatatagatggatttagggttgatgcagtggctaatatcttgtattggccaaatcag
gatgaacgccacacgaatccatatgctgttgattttttaaaaaaactcaatcaaaccatg
agagaggcatatccccatgtgatgatgattgcagaagattctacagaatggcctcaagtg
acaggtgccgttgaggaaggggggcttggttttcattataaatggaatatgggatggatg
aatgacgtactgaaatacatggagacgccgcccgaagaaaggcggcattgtcatcagctt
atctctttttcattactatatgcgtttagtgaacattttgtattgccgttttctcatgat
gaagtcgtatacggaaaaaaatcacttctcaataaaatgcctggcgactactggcagaaa
tttgcccagtatcggcttttgctgggctatatgacagtgcatcccggaaagaaattgatc
tttatgggatcagagtttgctcaatttgatgaatggaaagatacagaacagcttgattgg
tttttggactccttccccatgcatcagaaagccagcgtttttacgcaagatcttctccgc
ttttaccaaaaaagcaaaatcctttatgagcatgaccatcgtgcacaatcgtttgaatgg
attgatgtccataatgacgaacaatcaatcttttcttttattcgttatggccaaaagcac
ggtgaggcgcttgtcatcatttgtaattttacacccgtggtctatcatcaatatgatgtt
ggagttcctttttttactcaatacattgaagtgcttaacagtgacagtgaaacatatgga
ggctcagggcaaatcaacaaaaagccgttatcggctaaaaagggagcacttcatcataaa
ccgtgttatatcacgatgaccatccccccttacggcatctcgattttacgggcggttaaa
aaaagaggagagataaaaagatga

DBGET integrated database retrieval system