KEGG   Bacillus subtilis PY79: U712_15545Help
Entry
U712_15545        CDS       T02937                                 

Definition
Protein-glutamine gamma-glutamyltransferase (EC:2.3.2.13)
Orthology
K00686  
protein-glutamine gamma-glutamyltransferase [EC:2.3.2.13]
Organism
bsp  Bacillus subtilis PY79
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3030445..3031182
Genome map
AA seq 245 aa AA seqDB search
MIIVSGQLLRPQDIENWQIDQDLNPLLKEMIETPVQFDYHSIAELMFELKLRMNIVAAAK
TLHKSGAKFATFLKTYGNTTYWRVSPEGALELKYRMPPSKAIRDIAENGPFYAFECATAI
VIIYYLALIDTIGEDKFNASFDRIILYDWHYEKLPIYTETGHHFFLGDCLYFKNPEFDPQ
KAQWRGENVILLGEDKYFAHGLGILNGKQIIDKLNSFRKKGALQSAYLLSQATRLDVPSL
FRIVR
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgattattgtatcaggacaattgctccgtccccaggatattgaaaattggcagattgat
caagatctgaatccgctcttaaaagagatgattgagacgcctgttcagtttgattatcat
tcaattgctgaactgatgtttgagcttaaactgcggatgaatattgtagcagcggcaaag
acgctgcacaaaagcggggcgaagtttgccacttttttaaaaacatacgggaatacaacg
tattggagggtttcaccggagggcgccttggagctgaaatacagaatgccgccttcaaaa
gcgattcgggacattgcagagaacggcccgttttatgcgtttgaatgcgcaaccgcaatc
gttatcatttattacttggccttaatcgatacaatcggagaagataaattcaatgccagc
tttgacagaattattttatatgactggcattatgagaaattgccgatatatacggaaaca
ggacaccactttttccttggagattgtttgtattttaagaatcctgaatttgatccgcaa
aaggcgcaatggagaggcgaaaatgtgatactactgggggaagataaatattttgcccat
ggtcttggaatcttaaacggaaagcaaattattgataagctgaattcttttaggaaaaaa
ggagccttacagtcagcctaccttctgtctcaggcgaccagactggatgttccgtctctt
ttccgcatcgtccgctaa

DBGET integrated database retrieval system