KEGG   Bacillus subtilis PY79: U712_18040Help
Entry
U712_18040        CDS       T02937                                 

Definition
Ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
bsp  Bacillus subtilis PY79
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:bsp00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    U712_18040
Enzymes [BR:bsp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     U712_18040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3520280..3521128
Genome map
AA seq 282 aa AA seqDB search
MDLVVTSDKRPKAGETVLGTSFQTVPGGKGANQAVAAARLGAQVFMVGKVGDDHYGTAIL
NNLKANGVRTDYMEPVTHTESGTAHIVLAEGDNSIVVVKGANDDITPAYALNALEQIEKV
DMVLIQQEIPEETVDEVCKYCHSHDIPIILNPAPARPLKQETIDHATYLTPNEHEASILF
PELTISEALALYPAKLFITEGKQGVRYSAGSKEVLIPSFPVEPVDTTGAGDTFNAAFAVA
LAEGKDIEAALRFANRAASLSVCSFGAQGGMPTRNEVEELLS
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atggatttagtggtcacctcggacaaacgcccaaaagccggtgaaacggttcttggcacg
tcatttcagactgtgccgggcggcaaaggagcaaatcaggccgttgccgcagccagactt
ggggcgcaagtgtttatggtcggcaaagttggagacgatcattatggaacagctattttg
aataatctcaaagctaacggcgttcgcactgattatatggaaccggttacacatacggaa
agcggaaccgctcatattgtgcttgctgaaggcgacaacagcattgtcgttgtcaaaggc
gcgaacgatgacatcaccccagcgtatgcgttaaacgcgctcgaacagattgaaaaggtc
gatatggtgctgattcagcaggaaatcccagaagaaacggttgatgaggtgtgcaaatac
tgccattctcacgatatcccgatcatactaaacccagcaccggcccgcccgctcaagcag
gaaacaattgatcacgctacctatctgacgccgaatgaacacgaggcttcgattttattc
cctgagcttaccatttccgaagctctggcgctttatccggcaaagctctttattacggaa
ggaaaacaaggcgtccgctattcggctggcagcaaagaggtgctcatcccgtccttccct
gtagaacccgttgatacaaccggagccggtgatacgtttaacgcagcatttgccgtggcc
ctggctgagggaaaagacattgaagccgcattgcggtttgccaatcgtgccgcttccctt
tctgtctgctccttcggtgcccaaggcggaatgccgacaagaaatgaagtagaggagctg
ctgtcatga

DBGET integrated database retrieval system