KEGG   Bacillus subtilis QB928: B657_00920Help
Entry
B657_00920        CDS       T02292                                 

Gene name
gltX
Definition
glutamyl-tRNA synthetase (EC:6.1.1.17)
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
bsq  Bacillus subtilis QB928
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:bsq00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    B657_00920 (gltX)
Enzymes [BR:bsq01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.24  glutamate---tRNAGln ligase
     B657_00920 (gltX)
Amino acid related enzymes [BR:bsq01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   B657_00920 (gltX)
Transfer RNA biogenesis [BR:bsq03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    B657_00920 (gltX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
111047..112498
Genome map
AA seq 483 aa AA seqDB search
MGNEVRVRYAPSPTGHLHIGNARTALFNYLFARNQGGKFIIRVEDTDKKRNIEGGEQSQL
NYLKWLGIDWDESVDVGGEYGPYRQSERNDIYKVYYEELLEKGLAYKCYCTEEELEKERE
EQIARGEMPRYSGKHRDLTQEEQEKFIAEGRKPSIRFRVPEGKVIAFNDIVKGEISFESD
GIGDFVIVKKDGTPTYNFAVAIDDYLMKMTHVLRGEDHISNTPKQIMIYQAFGWDIPQFG
HMTLIVNESRKKLSKRDESIIQFIEQYKELGYLPEALFNFIGLLGWSPVGEEELFTKEQF
IEIFDVNRLSKSPALFDMHKLKWVNNQYVKKLDLDQVVELTLPHLQKAGKVGTELSAEEQ
EWVRKLISLYHEQLSYGAEIVELTDLFFTDEIEYNQEAKAVLEEEQVPEVLSTFAAKLEE
LEEFTPDNIKASIKAVQKETGHKGKKLFMPIRVAVTGQTHGPELPQSIELIGKETAIQRL
KNI
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgggaaacgaagtacgcgtccgttatgcaccgagtccaaccggacatttgcatattgga
aatgccagaacggcgctttttaattatttatttgcccgcaatcaaggcggtaagtttatc
attcgagttgaggatactgataaaaagcgcaatattgagggcggagaacaaagccagctg
aattatctgaagtggctaggtattgactgggatgagagtgtggatgtcggaggagagtac
ggtccataccgtcagtcagagcgtaacgatatctataaagtgtactatgaagagcttctt
gaaaaagggcttgcttataaatgttactgtacggaagaagagcttgaaaaagagcgtgaa
gaacagattgcccgcggagaaatgcctcgttattccggaaaacacagagacctgactcag
gaagaacaggagaaatttatcgccgaaggcagaaaaccaagtattcgtttccgtgtgccg
gaaggaaaagtcatcgccttcaacgacatcgtaaaaggcgaaatttcttttgaatcagat
ggcatcggcgacttcgttattgtgaaaaaggacggaacgcctacttataacttcgcggta
gctattgatgactacttaatgaaaatgacacacgtgctgcgcggtgaggatcatatttct
aacacaccgaaacagattatgatctatcaagcattcgggtgggatattcctcagttcgga
cacatgacgctgattgtaaacgaaagccgtaaaaagctcagcaaacgtgatgaatccatt
attcaattcatcgagcagtacaaagagcttggctacctgccagaagcgctgttcaacttt
atcggcttgttaggctggtcaccggttggagaagaagagcttttcacaaaagagcagttt
attgaaatttttgatgtaaatcgtttatctaaatcaccagctttgtttgatatgcataag
ctaaaatgggttaacaaccaatatgtgaagaagctggatcttgatcaggttgttgaactg
acgcttccgcatttgcaaaaagccggcaaagttggcactgagctttctgctgaagaacaa
gaatgggttcgtaaactgatttccctgtatcatgagcaattaagctacggtgcggaaatt
gttgagctgactgatttgttctttacggatgagatcgagtataatcaagaagcgaaagct
gttctggaagaagaacaggttcctgaagtgctcagcacattcgcagcgaagcttgaagag
cttgaggagttcactccggataatatcaaagcatcgatcaaagcagtgcagaaagaaact
ggccataaagggaaaaaactgtttatgccgattcgtgttgctgtaacagggcaaactcac
ggtccggaactgccgcaatcaattgaattgatcggtaaagagactgcaattcagcgttta
aagaatatctaa

DBGET integrated database retrieval system