KEGG   Bacillus subtilis QB928: B657_01660Help
Entry
B657_01660        CDS       T02292                                 

Gene name
nagZ
Definition
N-acetylglucosaminidase lipoprotein (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
bsq  Bacillus subtilis QB928
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bsq00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:bsq00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(186464..188392)
Genome map
AA seq 642 aa AA seqDB search
MRPVFPLILSAVLFLSCFFGARQTEASASKRAIDANQIVNRMSLDEKLGQMLMPDFRNWQ
KEGESSPQALTKMNDEVASLVKKYQFGGIILFAENVKTTKQTVQLTDDYQKASPKIPLML
SIDQEGGIVTRLGEGTNFPGNMALGAARSRINAYQTGSIIGKELSALGINTDFSPVVDIN
NNPDNPVIGVRSFSSNRELTSRLGLYTMKGLQRQDIASALKHFPGHGDTDVDSHYGLPLV
SHGQERLREVELYPFQKAIDAGADMVMTAHVQFPAFDDTTYKSKLDGSDILVPATLSKKV
MTGLLRQEMGFNGVIVTDALNMKAIADHFGQEEAVVMAVKAGVDIALMPASVTSLKEEQK
FARVIQALKEAVKNGDIPEQQINNSVERIISLKIKRGMYPARNSDSTKEKIAKAKKIVGS
KQHLKAEKKLAEKAVTVLKNEQHTLPFKPKKGSRILIVAPYEEQTASIEQTIHDLIKRKK
IKPVSLSKMNFASQVFKTEHEKQVKEADYIITGSYVVKNDPVVNDGVIDDTISDSSKWAT
VFPRAVMKAALQHNKPFVLMSLRNPYDAANFEEAKALIAVYGFKGYANGRYLQPNIPAGV
MAIFGQAKPKGTLPVDIPSVTKPGNTLYPLGYGLNIKTGRPL
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atgagacctgtctttccgcttatcctttcagccgttctctttctttcatgctttttcggg
gccagacagacagaagcctctgcatccaaacgtgcaatcgatgccaatcagattgtcaat
cgtatgtcgttagatgaaaaactcggccagatgctgatgcctgattttagaaattggcaa
aaggaaggcgagtcctctccgcaagcccttacaaaaatgaatgatgaagtcgccagcctc
gtcaagaaatatcaattcggaggcatcatcctttttgcagaaaatgtaaaaacaacaaaa
caaactgtccaactgacagacgattaccaaaaggcaagtccaaaaatcccgctcatgctg
agtattgatcaggaaggcggcattgtaacgaggttaggggagggcactaatttcccaggg
aatatggcgctgggcgcagccagaagcagaatcaatgcgtatcagaccggcagcatcatc
ggaaaagagctctctgccttaggcatcaatacagatttcagccctgtcgtggacattaac
aataatcctgataatcctgtaatcggcgtacggtcattcagctccaatcgagaactgaca
tcacgcctcggtttatatacgatgaaagggttgcagcggcaggatatcgcgtctgccctc
aaacatttcccgggacatggagacacggacgttgacagccattatggactgccgctcgtt
tcccatggccaagaacggcttcgtgaggtcgagctttatccttttcaaaaagcaattgat
gctggtgctgatatggtgatgacagcccatgttcagtttcccgcctttgatgacaccact
tacaaaagcaaactcgatggatcggacattctggttccagctacactttcaaaaaaagtg
atgacaggtcttcttcgtcaggaaatgggctttaatggggtcatcgttaccgatgcgctc
aatatgaaggcaatcgcagatcatttcggacaggaagaggctgtggtcatggccgtaaaa
gctggtgtcgatattgcattaatgccagcctcagtcacttcattgaaagaagaacagaaa
ttcgcacgtgttattcaagctttgaaagaagccgtgaaaaacggggatattcctgaacaa
caaatcaacaattcagttgaaagaatcatttccctgaaaataaaacgcggcatgtatcca
gcgcgaaacagcgacagtacaaaagaaaaaatagccaaagccaaaaaaatcgtaggaagc
aagcagcacctgaaagcagagaaaaaattagctgaaaaagcagtaactgtattaaaaaat
gaacagcacactttgccgttcaagcctaaaaaaggcagccgaatcttaattgtggcacct
tacgaagaacaaactgcttcaatcgaacaaaccattcacgatctcatcaagcgaaagaaa
atcaaacccgtatccctcagcaaaatgaactttgccagccaagtatttaagaccgagcat
gaaaaacaagtaaaagaggctgattatatcattaccggctcctatgtcgtcaaaaatgac
cctgtcgtcaacgacggtgtcatcgacgacacaatatcagattcaagcaaatgggccacc
gtgtttccgagagctgtcatgaaagccgcactgcagcacaacaaaccatttgtcttaatg
agcctgcgcaacccctatgacgcagccaatttcgaagaagcaaaagcactgattgcagtc
tatggctttaaaggatacgcaaatggccgttatcttcaacctaatattccggccggagtg
atggcgatattcggccaggcaaaacctaaaggcacacttccagttgacattccgtcagtc
acgaaaccagggaacaccctttacccacttggctacggattaaatatcaaaacgggaaga
ccgctttaa

DBGET integrated database retrieval system