KEGG   Bacillus subtilis QB928: B657_05840Help
Entry
B657_05840        CDS       T02292                                 

Gene name
gmuD
Definition
mannoside-phospho-beta-d-glucosidase (EC:3.2.1.21)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
bsq  Bacillus subtilis QB928
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bsq00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
608131..609528
Genome map
AA seq 465 aa AA seqDB search
MAHTEQYRFPKDFWWGSSASATQMEGAADRDGKGQNIWDYWFEKEPHRFFDHVGPADTSQ
FYDNYKEDIRLMKELGHNSFRMSISWSRLIPNGTGEINDKAADFYNNVIDELIANGIEPF
VNLFHFDMPMALQKIGGWVNRETVDAYENYARTCFRLFGGRVKKWFTHNEPIVPVEGGYL
YDFHYPNKVDFKEAVQVGFHTMLSSARAIQAYREMKQDGKIGIILNLTPSYPRSSHPADV
KAGEIADAFFNRSFLDPSVKGEFPKELVDILKHEGFMPDYNAEDLDIIKKNTVDLLGVNY
YQPRRVKAKEHLPNPDAPFLPDRYFDPYVMPGRKMNPHRGWEIYEKGVYDILINLKENYG
NIECFISENGMGVEGEERFRDEQGIIQDDYRIEFIKEHLKWIHRAIQEGSNVKGYHLWTF
MDNWSWTNAYKNRYGFVSVNLEKDGERTVKKSGKWFKEVAEHSGF
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
ttggcacatacagaacaatatcgttttccaaaggatttttggtggggatcatccgcttca
gcaacacaaatggagggtgccgccgacagagacggaaaaggccagaatatatgggattat
tggtttgaaaaagaaccgcatcgtttttttgatcatgtcggacccgcagacacatcccaa
ttttacgacaactataaagaagatatcaggctgatgaaggaacttggccacaactcgttc
cggatgtcgatttcctggtcacgtttaataccaaacggaacgggcgagatcaacgataaa
gccgcagatttctataacaatgtcattgatgagctgatcgctaacggaattgaacctttt
gtcaatttgtttcatttcgatatgccgatggcgcttcaaaaaatcggcggctgggtcaac
agagagacggttgacgcgtatgaaaactatgcaagaacttgcttccgtttgtttggcggc
cgggtgaaaaaatggttcacgcataatgaaccaatcgttcccgtagaaggcggataccta
tatgattttcattatccaaacaaggtcgattttaaagaggccgtccaggttggatttcat
acgatgctatcaagtgcccgcgccattcaggcttacagggagatgaagcaggacggaaaa
atcggcatcatcttaaatttgaccccttcatacccgagaagcagccatccggcggatgtg
aaagccggggaaatcgcagacgcgttttttaacagatcttttttagacccatctgtcaaa
ggcgaatttcccaaagagctggttgacattttgaagcatgaaggctttatgcctgattac
aacgctgaagatctcgacatcatcaaaaagaacacggttgacctgttgggagtgaattat
taccagccgagacgtgtgaaagcgaaagaacatcttccgaatcccgacgctccttttttg
ccggacaggtattttgatccctacgtcatgccgggccgcaaaatgaatccgcatcgcggc
tgggagatctatgaaaaaggcgtttatgatattttgatcaatttaaaagaaaactacggc
aacatcgagtgttttatctctgaaaacggtatgggggttgaaggtgaagagcgattcagg
gatgaacaaggcatcattcaggatgattaccggattgaatttataaaagagcacctcaaa
tggattcaccgcgccatacaggaaggctcgaacgtaaaaggctatcacttatggacgttc
atggacaactggtcttggacaaatgcctataaaaaccgatacggatttgtatcagtcaat
cttgagaaagacggagaaagaaccgtcaaaaagagcggaaaatggttcaaagaggttgct
gagcatagcggtttctag

DBGET integrated database retrieval system