KEGG   Bacillus subtilis QB928: B657_07250Help
Entry
B657_07250        CDS       T02292                                 

Gene name
cypD
Definition
bifunctional P-450/NADPH-P450 reductase (EC:1.14.14.1 1.6.2.4)
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
bsq  Bacillus subtilis QB928
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Class
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:bsq00071]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:bsq00380]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:bsq00627]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
772182..775367
Genome map
AA seq 1061 aa AA seqDB search
MKETSPIPQPKTFGPLGNLPLIDKDKPTLSLIKLAEEQGPIFQIHTPAGTTIVVSGHELV
KEVCDEERFDKSIEGALEKVRAFSGDGLFTSWTHEPNWRKAHNILMPTFSQRAMKDYHEK
MVDIAVQLIQKWARLNPNEAVDVPGDMTRLTLDTIGLCGFNYRFNSYYRETPHPFINSMV
RALDEAMHQMQRLDVQDKLMVRTKRQFRYDIQTMFSLVDSIIAERRANGDQDEKDLLARM
LNVEDPETGEKLDDENIRFQIITFLIAGHETTSGLLSFATYFLLKHPDKLKKAYEEVDRV
LTDAAPTYKQVLELTYIRMILNESLRLWPTAPAFSLYPKEDTVIGGKFPITTNDRISVLI
PQLHRDRDAWGKDAEEFRPERFEHQDQVPHHAYKPFGNGQRACIGMQFALHEATLVLGMI
LKYFTLIDHENYELDIKQTLTLKPGDFHISVQSRHQEAIHADVQAAEKAAPDEQKEKTEA
KGASVIGLNNRPLLVLYGSDTGTAEGVARELADTASLHGVRTKTAPLNDRIGKLPKEGAV
VIVTSSYNGKPPSNAGQFVQWLQEIKPGELEGVHYAVFGCGDHNWASTYQYVPRFIDEQL
AEKGATRFSARGEGDVSGDFEGQLDEWKKSMWADAIKAFGLELNENADKERSTLSLQFVR
GLGESPLARSYEASHASIAENRELQSADSDRSTRHIEIALPPDVEYQEGDHLGVLPKNSQ
TNVSRILHRFGLKGTDQVTLSASGRSAGHLPLGRPVSLHDLLSYSVEVQEAATRAQIREL
ASFTVCPPHRRELEELSAEGVYQEQILKKRISMLDLLEKYEACDMPFERFLELLRPLKPR
YYSISSSPRVNPRQASITVGVVRGPAWSGRGEYRGVASNDLAERQAGDDVVMFIRTPESR
FQLPKDPETPIIMVGPGTGVAPFRGFLQARDVLKREGKTLGEAHLYFGCRNDRDFIYRDE
LERFEKDGIVTVHTAFSRKEGMPKTYVQHLMADQADTLISILDRGGRLYVCGDGSKMAPD
VEAALQKAYQAVHGTGEQEAQNWLRHLQDTGMYAKDVWAGI
NT seq 3186 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaaacaagcccgattcctcagccgaagacgtttgggccgctcggcaatttgcct
ttaattgataaagacaaaccgacgctttcgctgatcaaactggcggaagaacagggcccg
atttttcaaatccatacacccgcgggcacgaccattgtagtgtccggccatgaattggtg
aaagaggtttgtgatgaagaacggtttgataaaagcattgaaggcgccttggaaaaggtt
cgcgcattttccggtgacggattgtttacgagctggacgcatgagcctaactggagaaaa
gcgcacaacattctgatgccgacgttcagccagcgggccatgaaggactatcatgagaaa
atggtcgatatcgctgttcagctcattcaaaaatgggcaaggctcaacccgaatgaagca
gtcgatgtcccgggagatatgacccggctgacgctcgacaccattgggctatgcgggttt
aactaccgctttaacagttactacagagaaacgccccacccgtttatcaacagcatggtg
cgggcgcttgatgaagcgatgcatcaaatgcagcggcttgatgttcaagataagcttatg
gtcagaacaaagcggcaattccgctatgatattcaaacgatgttttcgttagtcgacagc
attattgcagagcgcagggcgaatggagaccaggatgaaaaagatttgctcgcccgcatg
ctgaatgtggaagatccggaaactggtgaaaagctcgacgacgaaaatatccgctttcag
atcatcacgtttttgattgccggccatgaaacaacgagcggcctgctttcctttgcgact
tactttttattgaagcatcctgacaaactgaaaaaggcgtatgaagaggtcgatcgggtg
ctgacggatgcagcgccgacctataaacaagtgctggagcttacatacatacggatgatt
ttaaatgaatcactgcgcttatggccgacagctccggctttcagcctttatccaaaagaa
gacacagtcattggcggaaaatttccgatcacgacgaatgacagaatttctgtgctgatt
ccgcagcttcatcgtgatcgagacgcttggggaaaggacgcagaagaattccggccggaa
cggtttgagcatcaggaccaagtgcctcatcatgcgtacaaaccattcggaaatggacaa
cgggcctgtatcggcatgcagtttgcccttcatgaagccacacttgtgttaggcatgatt
ctaaaatatttcacattgattgatcatgagaattatgagcttgatatcaaacaaacctta
acacttaagccgggcgattttcacatcagtgttcaaagccgtcatcaggaagccattcat
gcagacgtccaggcagctgaaaaagccgcgcctgatgagcaaaaggagaaaacggaagca
aagggtgcatcggtcatcggtcttaacaaccgcccgcttctcgtgctgtacggctcagat
accggcaccgcagaaggcgtcgcccgggagcttgctgatactgccagtcttcacggcgta
aggacaaagacagcacctctgaacgaccggattggaaagctgccgaaagagggagcggtt
gtcattgtgacctcgtcttataatggaaagccgccaagcaatgccggacaattcgtgcag
tggcttcaagaaatcaaaccgggtgagcttgagggcgtccattacgcggtatttggctgc
ggcgaccacaactgggcgagcacgtatcaatacgtgccgagattcattgatgagcagctt
gcggagaaaggcgcgactcggttttctgcgcgcggggaaggggatgtgagcggtgatttt
gaagggcagcttgacgagtggaaaaaaagcatgtgggcggatgccatcaaagcattcgga
cttgagcttaatgaaaacgctgataaggaacgaagcacgctgagccttcagtttgtcaga
gggctgggcgagtctccgctcgctagatcgtacgaagcctctcacgcatccattgccgaa
aatcgtgaactccagtccgcagacagcgatcgaagcactcgccatatcgaaattgcattg
ccgccggatgttgaatatcaagagggcgaccatcttggcgtattgccaaaaaacagccaa
accaatgtcagccggattcttcacagattcggtctgaagggaaccgaccaagtgacattg
tcggcaagcggccgcagtgcggggcatctgccattgggccgtcctgtcagcctgcatgat
cttctcagctacagcgtcgaggtgcaggaagcagccacaagagcgcaaatacgtgaactg
gcgtcatttacagtgtgtccgccgcataggcgcgaattagaagaactgtcagcagagggt
gtttatcaggagcaaatattgaaaaaacgaatttccatgctggatctgcttgaaaagtat
gaagcgtgtgacatgccgtttgaacgatttttagagcttttacggccgttaaaaccgaga
tactattcgatttcaagctctccaagagtgaatccgcggcaagcatcgatcacagtcggt
gtcgtgcgcggcccggcgtggagcggccgtggcgaatacaggggtgtggcatcaaatgat
ttagctgagcgtcaagccggtgatgatgtcgtgatgtttatccgcacaccggaatcccgg
tttcagcttccgaaagaccctgaaacgccaattattatggtcgggccaggcacgggagtc
gcgccatttcgcggtttccttcaagcccgcgatgttttaaagcgggagggcaaaacgctc
ggtgaggctcatctctattttggatgcaggaacgatcgggattttatttaccgagatgag
cttgagcggtttgaaaaagacggaatcgtcactgtccacacagccttttcccgaaaagag
ggcatgccgaaaacatatgtccagcatctcatggctgaccaagcagatacattaatatca
atccttgaccgcggtggcaggctttatgtatgcggtgatggcagcaaaatggccccggat
gtggaggcggcacttcaaaaagcgtatcaggctgtccatggaaccggggaacaagaagcg
caaaactggctgagacatctgcaggataccggtatgtacgctaaggatgtctgggcaggg
atatag

DBGET integrated database retrieval system