KEGG   Bacillus subtilis QB928: B657_10140Help
Entry
B657_10140        CDS       T02292                                 

Gene name
hemY
Definition
protoporphyrinogen IX and coproporphyrinogen III oxidase (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
bsq  Bacillus subtilis QB928
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:bsq00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
1067687..1069105
Genome map
AA seq 472 aa AA seqDB search
MNMSDGKKHVVIIGGGITGLAAAFYMEKEIKEKNLPLELTLVEASPRVGGKIQTVKKDGY
IIERGPDSFLERKKSAPQLVKDLGLEHLLVNNATGQSYVLVNRTLHPMPKGAVMGIPTKI
APFVSTGLFSLSGKARAAMDFILPASKTKDDQSLGEFFRRRVGDEVVENLIEPLLSGIYA
GDIDKLSLMSTFPQFYQTEQKHRSLILGMKKTRPQGSGQQLTAKKQGQFQTLSTGLQTLV
EEIEKQLKLTKVYKGTKVTKLSHSGSCYSLELDNGVTLDADSVIVTAPHKAAAGMLSELP
AISHLKNMHSTSVANVALGFPEGSVQMEHEGTGFVISRNSDFAITACTWTNKKWPHAAPE
GKTLLRAYVGKAGDESIVDLSDNDIINIVLEDLKKVMNINGEPEMTCVTRWHESMPQYHV
GHKQRIKELREALASAYPGVYMTGASFEGVGIPDCIDQGKAAVSDALTYLFS
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgaacatgagtgacggcaaaaaacatgtagtcatcatcggcggcggcattaccggttta
gccgccgccttctatatggaaaaagaaatcaaagaaaagaatctgccgcttgagctgaca
cttgttgaggcaagtccgagagtcggcgggaaaatccagactgtcaagaaagacggctat
atcatcgaaagagggccagactcatttctggaacgaaagaaaagcgccccgcagcttgtt
aaagacttaggtcttgagcatttgcttgtcaacaatgcgaccgggcaatcctatgtgctt
gtaaaccgcaccctgcatccaatgccgaagggcgctgtaatggggataccgacaaaaatt
gcgccgtttgtttctacgggtctgttttccttgtccgggaaggcgagagctgctatggat
ttcatcctgcctgcaagcaaaacaaaggatgatcagtcattgggagaattcttccgcaga
cgtgtcggagatgaagtggtcgagaacttaatcgagccgctactatcagggatctacgca
ggcgacattgacaagctcagcctgatgtcgacatttccgcaattttatcagacggaacaa
aagcatagaagcctgattctcggcatgaaaaaaacaaggcctcaaggctcaggccagcag
ctgacggcaaaaaaacaagggcagttccaaactctgtcaaccggtttgcagacccttgta
gaagagatcgaaaagcagttaaagctgacgaaggtgtataaaggcacaaaagtgaccaaa
cttagccatagcggctcttgctattcgctcgaactggataacggcgtcacacttgatgct
gattcagtaattgtgactgctccgcataaagcggctgcgggaatgctttctgagcttcct
gccatttctcatttgaaaaatatgcactccacatccgtggcaaacgtcgctttaggtttc
cctgaaggctccgtccaaatggagcatgagggcacgggttttgtcatttcaagaaacagt
gactttgcgatcacagcctgtacgtggacgaataaaaaatggccgcacgcagcgccggaa
ggcaaaacgctgcttcgggcatatgtcggaaaagccggagacgaatccattgtcgatcta
tcagataatgacattatcaacattgtgttagaagacttaaagaaagtcatgaacataaac
ggcgagccggaaatgacatgtgtaacccgatggcatgaaagcatgccgcagtaccatgtc
ggccataagcagcgtatcaaggagctgcgtgaagcacttgcatctgcgtatccgggtgtt
tatatgacaggcgcttctttcgaaggtgtcggcattcccgactgcattgatcaaggaaaa
gctgccgtgtctgacgcgcttacctatttattcagctaa

DBGET integrated database retrieval system