KEGG   Bacillus subtilis QB928: B657_12230Help
Entry
B657_12230        CDS       T02292                                 

Gene name
yjjA
Definition
hypothetical protein
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
bsq  Bacillus subtilis QB928
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bsq00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    B657_12230 (yjjA)
Enzymes [BR:bsq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     B657_12230 (yjjA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1273610..1274446
Genome map
AA seq 278 aa AA seqDB search
MQRGEETGMGKGLLGKRVAIGGSRKTEEISTIIEKQGGIPVIRPLQGTVYLAEKQVEPDL
RTFAEEKADWVIFTTGIGLETLVDMAEKIGLKDEFLQAIRQAKAACRGYKTLSALKKLGI
TPEASDEDGTTRGLIRSLEPHDFSGKTVMVQLHGEKAPALMAFLEEKGASVLPILPYQHI
PPEEETVERLCRELMNDEVDAVCFTTAIQVRSLFDFAKGRGYINEVKKVFEERAIAAAVG
KVTAEALREEGITRLLAPEIERMGAMIVELAKYYEEKE
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgcaaagaggagaggaaacgggtatgggaaaagggttacttggaaaacgcgtggcaatc
ggtggctcacgaaaaacggaagaaattagtacaatcattgaaaaacagggcggaatacct
gtcatccggcctctccaaggtacagtttacttagcagagaagcaggtggagccggatttg
cggacgtttgcggaagaaaaagctgactgggtcattttcacgacaggcatcgggttggag
actcttgtcgatatggcagagaaaattggactgaaagatgagtttctgcaggccattcgc
caagcgaaagcggcatgccggggatacaaaacgctgtctgcgctgaaaaagcttggaatc
acaccggaagcttcggatgaagacgggacaacaagaggcttaatccgttccttggagcct
cacgacttttcaggaaaaacagtcatggtgcagcttcatggcgaaaaagcgccggctctc
atggcatttcttgaagaaaaaggcgcgtctgtcctgccgattctgccttatcagcacatc
ccgccggaggaggaaacggtggagcggttatgccgagagctgatgaacgatgaggtcgat
gccgtttgttttacaacggccattcaggttcgttccctgtttgattttgccaaggggcga
ggttatatcaatgaagtgaagaaggtattcgaagaacgcgccatcgcagctgctgtcgga
aaagtgactgctgaagcactgcgggaagagggcattacgagactgcttgcgccagagatt
gagcggatgggtgcgatgattgttgagctggccaagtattatgaagaaaaggaataa

DBGET integrated database retrieval system