KEGG   Bacillus subtilis QB928: B657_16550Help
Entry
B657_16550        CDS       T02292                                 

Gene name
dxr
Definition
(GenBank) 1-deoxy-D-xylulose-5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
bsq  Bacillus subtilis QB928
Pathway
bsq00900  Terpenoid backbone biosynthesis
bsq01100  Metabolic pathways
bsq01110  Biosynthesis of secondary metabolites
bsq01130  Biosynthesis of antibiotics
Module
bsq_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:bsq00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    B657_16550 (dxr)
Enzymes [BR:bsq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     B657_16550 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_redisom_C DXP_reductoisom DXPR_C Semialdhyde_dh Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: AFQ57592
Position
1702370..1703521
Genome map
AA seq 383 aa AA seqDB search
MKNICLLGATGSIGEQTLDVLRAHQDQFQLVSMSFGRNIDKAVPMIEVFQPKFVSVGDLD
TYHKLKQMSFSFECQIGLGEEGLIEAAVMEEVDIVVNALLGSVGLIPTLKAIEQKKTIAL
ANKETLVTAGHIVKEHAKKYDVPLLPVDSEHSAIFQALQGEQAKNIERLIITASGGSFRD
KTREELESVTVEDALKHPNWSMGAKITIDSATMMNKGLEVIEAHWLFDIPYEQIDVVLHK
ESIIHSMVEFHDKSVIAQLGTPDMRVPIQYALTYPDRLPLPDAKRLELWEIGSLHFEKAD
FDRFRCLQFAFESGKIGGTMPTVLNAANEVAVAAFLAGKIPFLAIEDCIEKALTRHQLLK
KPSLADIQEVDKDTRGYVNSILT
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaatatttgtcttttaggagcaacaggatcaatcggcgaacagactcttgatgta
ctgcgtgcacatcaagaccaatttcagctggtatctatgtcgtttggcagaaatattgat
aaggccgttccaatgattgaggtctttcagccgaagtttgtctctgtcggtgatctggat
acatatcataaattaaaacaaatgtctttttcttttgaatgccaaatcgggctgggagaa
gaaggactgatagaagcagcagtgatggaggaggttgacattgttgtcaacgctttgctt
ggaagcgtcggtcttatcccgacattaaaggcaattgaacagaaaaaaacaattgcgctt
gcaaataaggaaactcttgtcactgcagggcatatagtaaaagaacatgctaagaaatat
gatgttccgctgctgcctgttgacagtgagcattcagccatttttcaagctcttcaaggc
gaacaggctaaaaacattgaacgcctcatcattacggcatccggcggaagttttcgggac
aagacgcgggaggagctcgaatcagtaacggttgaagatgcattaaaacatccaaactgg
tcaatgggtgcaaaaattacaattgattcggctacaatgatgaataagggattagaggtg
atcgaggcacactggcttttcgatataccttatgaacaaattgatgtggttttacataag
gagagcatcatccattcaatggttgagttccatgataaaagtgtgatcgcacagctcgga
actccggatatgagagtccccattcaatatgcgctcacttatcctgaccgattgccatta
ccagatgcgaaaaggcttgaattatgggaaatcggcagccttcattttgagaaagctgat
tttgacaggttccgatgcttacaatttgcttttgaatcaggtaaaataggaggaacaatg
ccgacagtgctaaatgcggcaaacgaagtagctgtcgctgcctttttagctggcaagata
ccgtttttggctattgaagactgtatcgaaaaggcactaacccgccatcaattactgaaa
aaaccgagcctggcggacattcaagaagtggacaaagatacccggggatacgtcaattca
atactcacataa

DBGET integrated database retrieval system