KEGG   Bacillus subtilis QB928: B657_16550Help
Entry
B657_16550        CDS       T02292                                 

Gene name
dxr
Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
bsq  Bacillus subtilis QB928
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:bsq00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1702370..1703521
Genome map
AA seq 383 aa AA seqDB search
MKNICLLGATGSIGEQTLDVLRAHQDQFQLVSMSFGRNIDKAVPMIEVFQPKFVSVGDLD
TYHKLKQMSFSFECQIGLGEEGLIEAAVMEEVDIVVNALLGSVGLIPTLKAIEQKKTIAL
ANKETLVTAGHIVKEHAKKYDVPLLPVDSEHSAIFQALQGEQAKNIERLIITASGGSFRD
KTREELESVTVEDALKHPNWSMGAKITIDSATMMNKGLEVIEAHWLFDIPYEQIDVVLHK
ESIIHSMVEFHDKSVIAQLGTPDMRVPIQYALTYPDRLPLPDAKRLELWEIGSLHFEKAD
FDRFRCLQFAFESGKIGGTMPTVLNAANEVAVAAFLAGKIPFLAIEDCIEKALTRHQLLK
KPSLADIQEVDKDTRGYVNSILT
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaatatttgtcttttaggagcaacaggatcaatcggcgaacagactcttgatgta
ctgcgtgcacatcaagaccaatttcagctggtatctatgtcgtttggcagaaatattgat
aaggccgttccaatgattgaggtctttcagccgaagtttgtctctgtcggtgatctggat
acatatcataaattaaaacaaatgtctttttcttttgaatgccaaatcgggctgggagaa
gaaggactgatagaagcagcagtgatggaggaggttgacattgttgtcaacgctttgctt
ggaagcgtcggtcttatcccgacattaaaggcaattgaacagaaaaaaacaattgcgctt
gcaaataaggaaactcttgtcactgcagggcatatagtaaaagaacatgctaagaaatat
gatgttccgctgctgcctgttgacagtgagcattcagccatttttcaagctcttcaaggc
gaacaggctaaaaacattgaacgcctcatcattacggcatccggcggaagttttcgggac
aagacgcgggaggagctcgaatcagtaacggttgaagatgcattaaaacatccaaactgg
tcaatgggtgcaaaaattacaattgattcggctacaatgatgaataagggattagaggtg
atcgaggcacactggcttttcgatataccttatgaacaaattgatgtggttttacataag
gagagcatcatccattcaatggttgagttccatgataaaagtgtgatcgcacagctcgga
actccggatatgagagtccccattcaatatgcgctcacttatcctgaccgattgccatta
ccagatgcgaaaaggcttgaattatgggaaatcggcagccttcattttgagaaagctgat
tttgacaggttccgatgcttacaatttgcttttgaatcaggtaaaataggaggaacaatg
ccgacagtgctaaatgcggcaaacgaagtagctgtcgctgcctttttagctggcaagata
ccgtttttggctattgaagactgtatcgaaaaggcactaacccgccatcaattactgaaa
aaaccgagcctggcggacattcaagaagtggacaaagatacccggggatacgtcaattca
atactcacataa

DBGET integrated database retrieval system