KEGG   Bacillus subtilis QB928: B657_18130Help
Entry
B657_18130        CDS       T02292                                 

Gene name
eglS
Definition
endo-1,4-beta-glucanase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
bsq  Bacillus subtilis QB928
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:bsq00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
1920124..1921623
Genome map
AA seq 499 aa AA seqDB search
MKRSISIFITCLLITLLTMGGMIASPASAAGTKTPVAKNGQLSIKGTQLVNRDGKAVQLK
GISSHGLQWYGEYVNKDSLKWLRDDWGITVFRAAMYTADGGYIDNPSVKNKVKEAVEAAK
ELGIYVIIDWHILNDGNPNQNKEKAKEFFKEMSSLYGNTPNVIYEIANEPNGDVNWKRDI
KPYAEEVISVIRKNDPDNIIIVGTGTWSQDVNDAADDQLKDANVMYALHFYAGTHGQFLR
DKANYALSKGAPIFVTEWGTSDASGNGGVFLDQSREWLKYLDSKTISWVNWNLSDKQESS
SALKPGASKTGGWRLSDLSASGTFVRENILGTKDSTKDIPETPSKDKPTQENGISVQYRA
GDGSMNSNQIRPQLQIKNNGNTTVDLKDVTARYWYKAKNKGQNFDCDYAQIGCGNVTHKF
VTLHKPKQGADTYLELGFKNGTLAPGASTGNIQLRLHNDDWSNYAQSGDYSFFKSNTFKT
TKKITLYDQGKLIWGTEPN
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgaaacggtcaatctctatttttattacgtgtttattgattacgttattgacaatgggc
ggcatgatagcttcgccggcatcagcagcagggacaaaaacgccagtagccaagaatggc
cagcttagcataaaaggtacacagctcgttaaccgagacggtaaagcggtacagctgaag
gggatcagttcacacggattgcaatggtatggagaatatgtcaataaagacagcttaaaa
tggctgagagatgattggggtatcaccgttttccgtgcagcgatgtatacggcagatggc
ggttatattgacaacccgtccgtgaaaaataaagtaaaagaagcggttgaagcggcaaaa
gagcttgggatatatgtcatcattgactggcatatcttaaatgacggtaatccaaaccaa
aataaagagaaggcaaaagaattcttcaaggaaatgtcaagcctttacggaaacacgcca
aacgtcatttatgaaattgcaaacgaaccaaacggtgatgtgaactggaagcgtgatatt
aaaccatatgcggaagaagtgatttcagttatccgcaaaaatgatccagacaacatcatc
attgtcggaaccggtacatggagccaggatgtgaatgatgctgccgatgaccagctaaaa
gatgcaaacgttatgtacgcacttcatttttatgccggcacacacggccaatttttacgg
gataaagcaaactatgcactcagcaaaggagcacctatttttgtgacagagtggggaaca
agcgacgcgtctggcaatggcggtgtattccttgatcaatcgagggaatggctgaaatat
ctcgacagcaagaccattagctgggtgaactggaatctttctgataagcaggaatcatcc
tcagctttaaagccgggggcatctaaaacaggcggctggcggttgtcagatttatctgct
tcaggaacattcgttagagaaaacattctcggcaccaaagattcgacgaaggacattcct
gaaacgccatcaaaagataaacccacacaggaaaatggtatttctgtacagtacagagca
ggggatgggagtatgaacagcaaccaaatccgtccgcagcttcaaataaaaaataacggc
aataccacggttgatttaaaagatgtcactgcccgttactggtataaagcgaaaaacaaa
ggccaaaactttgactgtgactacgcgcagattggatgcggcaatgtgacacacaagttt
gtgacgttgcataaaccaaagcaaggtgcagatacctatctggaacttggatttaaaaac
ggaacgttggcaccgggagcaagcacagggaatattcagctccgtcttcacaatgatgac
tggagcaattatgcacaaagcggcgattattcctttttcaaatcaaatacgtttaaaaca
acgaaaaaaatcacattatatgatcaaggaaaactgatttggggaacagaaccaaattag

DBGET integrated database retrieval system