KEGG   Bacillus subtilis QB928: B657_18840Help
Entry
B657_18840        CDS       T02292                                 

Gene name
xynA
Definition
endo-1,4-beta-xylanase (EC:3.2.1.8)
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
bsq  Bacillus subtilis QB928
Brite
Enzymes [BR:bsq01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     B657_18840 (xynA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(2034094..2034735)
Genome map
AA seq 213 aa AA seqDB search
MFKFKKNFLVGLSAALMSISLFSATASAASTDYWQNWTDGGGIVNAVNGSGGNYSVNWSN
TGNFVVGKGWTTGSPFRTINYNAGVWAPNGNGYLTLYGWTRSPLIEYYVVDSWGTYRPTG
TYKGTVKSDGGTYDIYTTTRYNAPSIDGDRTTFTQYWSVRQSKRPTGSNATITFSNHVNA
WKSHGMNLGSNWAYQVMATEGYQSSGSSNVTVW
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgtttaagtttaaaaagaatttcttagttggattatcggcagctttaatgagtattagc
ttgttttcggcaaccgcctctgcagctagcacagactactggcaaaattggactgatggg
ggcggtatagtaaacgctgtcaatgggtctggcgggaattacagtgttaattggtctaat
accggaaattttgttgttggtaaaggttggactacaggttcgccatttaggacgataaac
tataatgccggagtttgggcgccgaatggcaatggatatttaactttatatggttggacg
agatcacctctcatagaatattatgtagtggattcatggggtacttatagacctactgga
acgtataaaggtactgtaaaaagtgatgggggtacatatgacatatatacaactacacgt
tataacgcaccttccattgatggcgatcgcactacttttacgcagtactggagtgttcgc
cagtcgaagagaccaaccggaagcaacgctacaatcactttcagcaatcatgtgaacgca
tggaagagccatggaatgaatctgggcagtaattgggcttaccaagtcatggcgacagaa
ggatatcaaagtagtggaagttctaacgtaacagtgtggtaa

DBGET integrated database retrieval system