KEGG   Bacillus subtilis QB928: B657_19360Help
Entry
B657_19360        CDS       T02292                                 

Gene name
odhB
Definition
2-oxoglutarate dehydrogenase complex(dihydrolipoamide transsuccinylase, E2 subunit) (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bsq  Bacillus subtilis QB928
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bsq00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    B657_19360 (odhB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    B657_19360 (odhB)
  Amino acid metabolism
   00310 Lysine degradation
    B657_19360 (odhB)
Enzymes [BR:bsq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     B657_19360 (odhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2087000..2088253)
Genome map
AA seq 417 aa AA seqDB search
MAEIKVPELAESISEGTIAQWLKQPGDYVEQGEYLLELETDKVNVELTAEESGVLQEVLK
DSGDTVQVGEIIGTISEGAGESSAPAPTEKTESKESVKEEKQAEPAAQEVSEEAQSEAKS
RTIASPSARKLAREKGIDLSQVPTGDPLGRVRKQDVEAYEKPASKPAPQQKQQPQAQKAQ
QSFDKPVEVQKMSRRRQTIAKRLVEVQQTSAMLTTFNEVDMTAVMNLRKRRKDQFFEQNE
VKLGFMSFFTKAVVAALKKYPLLNAEIQGDELIVKKFYDIGIAVAADEGLVVPVVRDADR
LTFAGIEKEIGELAKKARNNKLTLSELQGGSFTITNGGTFGSLMSTPILNSPQVGILGMH
KIQLRPVAIDEERFENRPMMYIALSYDHRIVDGKEAVGFLVTIKNLLEDPEQLLLEG
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaattaaggtacctgaattagcagaatcaatctcagaaggaacaatagcccaa
tggttaaagcagcctggtgactatgtagaacagggtgaatatctgcttgaactagaaacg
gataaagtgaatgttgaattgacagcagaagaatcgggtgtacttcaagaggtattgaaa
gattcgggtgataccgtccaggtcggagaaattatcggtacgatttcagaaggcgcgggt
gaaagttctgcccctgctcctacagagaaaacagaaagcaaggaaagcgtaaaagaagag
aaacaggctgaaccagctgcacaagaggtgagcgaggaagcacaatctgaagcaaaatca
agaacgatcgcttctccgtcggcccgtaagcttgcgagagaaaaaggaattgacctgtct
caagttccaactggagatccgcttggaagagtgcgcaagcaggatgtcgaagcgtacgaa
aaaccggcatcaaaaccggctcctcagcaaaagcagcagcctcaggctcaaaaagcacag
caaagctttgacaaacctgttgaagtgcaaaaaatgtcacgccgcagacaaacgattgca
aaacgccttgtagaggtacagcaaacatcagcgatgctgactacatttaatgaagtggac
atgacggctgtcatgaatctcagaaaacgccgcaaagatcaattttttgagcaaaatgaa
gtgaagctcggctttatgtctttcttcacgaaagcggtcgtggctgcattgaaaaaatat
ccgctgttgaatgcagaaattcaaggcgatgagttgatcgttaaaaaattctacgatatc
ggaatcgctgttgctgctgatgaaggtcttgtcgttccggttgtacgggatgcggatcgc
ctgacatttgcaggaatcgaaaaagagatcggcgagcttgcgaaaaaagcaagaaacaat
aaattaacccttagcgagcttcagggaggctccttcacgattacaaacggagggactttc
ggttcattgatgtcaactccaattttaaacagcccgcaagtcggtatactgggcatgcat
aagattcagctgcgccctgtagccattgatgaagagcgtttcgaaaaccgtccgatgatg
tatatcgctttatcttatgatcaccgaattgtagacggtaaagaagcggttggtttcctc
gtgacaatcaaaaatttactggaagatcctgaacagcttttattagaaggataa

DBGET integrated database retrieval system