KEGG   Bacillus subtilis QB928: B657_19360Help
Entry
B657_19360        CDS       T02292                                 

Gene name
odhB
Definition
(GenBank) 2-oxoglutarate dehydrogenase complex(dihydrolipoamide transsuccinylase, E2 subunit)
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bsq  Bacillus subtilis QB928
Pathway
bsq00020  Citrate cycle (TCA cycle)
bsq00310  Lysine degradation
bsq01100  Metabolic pathways
bsq01110  Biosynthesis of secondary metabolites
bsq01120  Microbial metabolism in diverse environments
bsq01130  Biosynthesis of antibiotics
bsq01200  Carbon metabolism
Module
bsq_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bsq_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bsq00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    B657_19360 (odhB)
  Amino acid metabolism
   00310 Lysine degradation
    B657_19360 (odhB)
Enzymes [BR:bsq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     B657_19360 (odhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: AFQ57876
Position
complement(2087000..2088253)
Genome map
AA seq 417 aa AA seqDB search
MAEIKVPELAESISEGTIAQWLKQPGDYVEQGEYLLELETDKVNVELTAEESGVLQEVLK
DSGDTVQVGEIIGTISEGAGESSAPAPTEKTESKESVKEEKQAEPAAQEVSEEAQSEAKS
RTIASPSARKLAREKGIDLSQVPTGDPLGRVRKQDVEAYEKPASKPAPQQKQQPQAQKAQ
QSFDKPVEVQKMSRRRQTIAKRLVEVQQTSAMLTTFNEVDMTAVMNLRKRRKDQFFEQNE
VKLGFMSFFTKAVVAALKKYPLLNAEIQGDELIVKKFYDIGIAVAADEGLVVPVVRDADR
LTFAGIEKEIGELAKKARNNKLTLSELQGGSFTITNGGTFGSLMSTPILNSPQVGILGMH
KIQLRPVAIDEERFENRPMMYIALSYDHRIVDGKEAVGFLVTIKNLLEDPEQLLLEG
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaattaaggtacctgaattagcagaatcaatctcagaaggaacaatagcccaa
tggttaaagcagcctggtgactatgtagaacagggtgaatatctgcttgaactagaaacg
gataaagtgaatgttgaattgacagcagaagaatcgggtgtacttcaagaggtattgaaa
gattcgggtgataccgtccaggtcggagaaattatcggtacgatttcagaaggcgcgggt
gaaagttctgcccctgctcctacagagaaaacagaaagcaaggaaagcgtaaaagaagag
aaacaggctgaaccagctgcacaagaggtgagcgaggaagcacaatctgaagcaaaatca
agaacgatcgcttctccgtcggcccgtaagcttgcgagagaaaaaggaattgacctgtct
caagttccaactggagatccgcttggaagagtgcgcaagcaggatgtcgaagcgtacgaa
aaaccggcatcaaaaccggctcctcagcaaaagcagcagcctcaggctcaaaaagcacag
caaagctttgacaaacctgttgaagtgcaaaaaatgtcacgccgcagacaaacgattgca
aaacgccttgtagaggtacagcaaacatcagcgatgctgactacatttaatgaagtggac
atgacggctgtcatgaatctcagaaaacgccgcaaagatcaattttttgagcaaaatgaa
gtgaagctcggctttatgtctttcttcacgaaagcggtcgtggctgcattgaaaaaatat
ccgctgttgaatgcagaaattcaaggcgatgagttgatcgttaaaaaattctacgatatc
ggaatcgctgttgctgctgatgaaggtcttgtcgttccggttgtacgggatgcggatcgc
ctgacatttgcaggaatcgaaaaagagatcggcgagcttgcgaaaaaagcaagaaacaat
aaattaacccttagcgagcttcagggaggctccttcacgattacaaacggagggactttc
ggttcattgatgtcaactccaattttaaacagcccgcaagtcggtatactgggcatgcat
aagattcagctgcgccctgtagccattgatgaagagcgtttcgaaaaccgtccgatgatg
tatatcgctttatcttatgatcaccgaattgtagacggtaaagaagcggttggtttcctc
gtgacaatcaaaaatttactggaagatcctgaacagcttttattagaaggataa

DBGET integrated database retrieval system