KEGG   Bacillus subtilis QB928: B657_22660Help
Entry
B657_22660        CDS       T02292                                 

Gene name
trpC
Definition
(GenBank) Indol-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
bsq  Bacillus subtilis QB928
Pathway
bsq00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bsq01100  Metabolic pathways
bsq01110  Biosynthesis of secondary metabolites
bsq01130  Biosynthesis of antibiotics
bsq01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bsq00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    B657_22660 (trpC)
Enzymes [BR:bsq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     B657_22660 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS His_biosynth
Motif
Other DBs
NCBI-ProteinID: AFQ58214
Position
complement(2353641..2354390)
Genome map
AA seq 249 aa AA seqDB search
MLEKIIKQKKEEVKTLVLPVEQPFEKRSFKEALASPNRFIGLIAEVKKASPSKGLIKEDF
VPVQIAKDYEAAKADAISVLTDTPFFQGENSYLSDVKRAVSIPVLRKDFIDSLQVEESRR
IGADAILLIGEVLDPLHLHELYLEAGEKGMDVLVEVHDASTLEQILKVFTPDILGVNNRN
LKTFETSVKQTEQIASLVPKESLLVSESGIGSLEHLTFVNEHGARAVLIGESLMRQTSQR
KAIHALFRE
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgcttgaaaaaatcatcaaacaaaagaaagaagaagtgaaaacactggttctgccggta
gagcagcctttcgagaaacgttcatttaaggaggcgctggcaagcccgaatcggtttatc
gggttgattgccgaagtgaagaaagcatcgccgtcaaaagggcttattaaagaggatttt
gtacctgtgcagattgcaaaagactatgaggctgcgaaggcagatgcgatttccgtttta
acagacaccccgttttttcaaggggaaaacagctatttatcagacgtaaagcgtgctgtt
tcgattcctgtacttagaaaagattttattgattctcttcaagtagaggaatcaagaaga
atcggagcggatgccatattgttaatcggcgaggtgcttgatcccttacaccttcatgaa
ttatatcttgaagcaggtgaaaaggggatggacgtgttagtggaggttcatgatgcatca
acgctagaacaaatattgaaagtgttcacacccgacattctcggcgtaaataatcgaaac
ctaaaaacgtttgaaacatctgtaaagcagacagaacaaatcgcatctctcgttccgaaa
gaatccttgcttgtcagcgaaagcggaatcggttctttagaacatttaacatttgtcaat
gaacatggggcgcgagctgtacttatcggtgaatcattgatgagacaaacttctcagcgt
aaagcaatccatgctttgtttagggagtga

DBGET integrated database retrieval system