KEGG   Bacillus subtilis QB928: B657_27160Help
Entry
B657_27160        CDS       T02292                                 

Gene name
cypB
Definition
cytochrome P450 CYP102A3
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
bsq  Bacillus subtilis QB928
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bsq00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    B657_27160 (cypB)
  Amino acid metabolism
   00380 Tryptophan metabolism
    B657_27160 (cypB)
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    B657_27160 (cypB)
Enzymes [BR:bsq01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     B657_27160 (cypB)
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     B657_27160 (cypB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2705329..2708493)
Genome map
AA seq 1054 aa AA seqDB search
MKQASAIPQPKTYGPLKNLPHLEKEQLSQSLWRIADELGPIFRFDFPGVSSVFVSGHNLV
AEVCDEKRFDKNLGKGLQKVREFGGDGLFTSWTHEPNWQKAHRILLPSFSQKAMKGYHSM
MLDIATQLIQKWSRLNPNEEIDVADDMTRLTLDTIGLCGFNYRFNSFYRDSQHPFITSML
RALKEAMNQSKRLGLQDKMMVKTKLQFQKDIEVMNSLVDRMIAERKANPDENIKDLLSLM
LYAKDPVTGETLDDENIRYQIITFLIAGHETTSGLLSFAIYCLLTHPEKLKKAQEEADRV
LTDDTPEYKQIQQLKYIRMVLNETLRLYPTAPAFSLYAKEDTVLGGEYPISKGQPVTVLI
PKLHRDQNAWGPDAEDFRPERFEDPSSIPHHAYKPFGNGQRACIGMQFALQEATMVLGLV
LKHFELINHTGYELKIKEALTIKPDDFKITVKPRKTAAINVQRKEQADIKAETKPKETKP
KHGTPLLVLFGSNLGTAEGIAGELAAQGRQMGFTAETAPLDDYIGKLPEEGAVVIVTASY
NGAPPDNAAGFVEWLKELEEGQLKGVSYAVFGCGNRSWASTYQRIPRLIDDMMKAKGASR
LTAIGEGDAADDFESHRESWENRFWKETMDAFDINEIAQKEDRPSLSITFLSEATETPVA
KAYGAFEGIVLENRELQTAASTRSTRHIELEIPAGKTYKEGDHIGILPKNSRELVQRVLS
RFGLQSNHVIKVSGSAHMAHLPMDRPIKVVDLLSSYVELQEPASRLQLRELASYTVCPPH
QKELEQLVSDDGIYKEQVLAKRLTMLDFLEDYPACEMPFERFLALLPSLKPRYYSISSSP
KVHANIVSMTVGVVKASAWSGRGEYRGVASNYLAELNTGDAAACFIRTPQSGFQMPNDPE
TPMIMVGPGTGIAPFRGFIQARSVLKKEGSTLGEALLYFGCRRPDHDDLYREELDQAEQD
GLVTIRRCYSRVENEPKGYVQHLLKQDTQKLMTLIEKGAHIYVCGDGSQMAPDVERTLRL
AYEAEKAASQEESAVWLQKLQDQRRYVKDVWTGM
NT seq 3165 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaggcaagcgcaatacctcagcccaaaacatacggacctttaaaaaatcttccg
catctggaaaaagaacagctttctcaatccttatggcggatagctgatgaattgggaccg
attttccgttttgattttccgggagtatccagtgtttttgtgtccggccacaatcttgtg
gctgaagtgtgtgatgaaaaacgctttgacaagaaccttggcaaaggcttgcaaaaggtg
cgtgagttcgggggagatggcttatttacaagctggacgcacgaaccgaactggcaaaaa
gcccaccgcattttgctgccgagttttagtcaaaaagcgatgaaaggctatcattctatg
atgctggatatcgcaacccagctgattcaaaagtggagccggttaaaccctaatgaagaa
attgatgtagcggacgatatgacacgtctgacgcttgatacgattgggttatgcgggttt
aactatcgattcaacagcttttaccgtgattcacagcatccgtttatcaccagtatgctc
cgtgccttaaaagaggcgatgaatcaatcgaaaagactgggcctgcaagataaaatgatg
gtgaaaacgaagctgcagttccaaaaggatatagaagtcatgaactccctggttgataga
atgatagcggagcgaaaggcgaatccggatgaaaacattaaggatctcttgtctctcatg
ctttatgccaaagatccagtaacgggtgaaacgctggatgacgaaaacattcgataccaa
atcatcacatttttaattgctggacatgagacaacaagcgggttgctatcctttgcgatt
tattgtctgcttacacatccggaaaaactgaaaaaagctcaggaggaagcggatcgcgtg
ttaacggatgacacgcctgaatataaacaaatccagcagctcaaatacattcggatggtt
ttaaatgaaaccctcagactgtatccaacagctccggctttttctctatatgcgaaggag
gatactgttctaggcggggaatatccgatcagcaaagggcagccagtcactgttttaatt
ccaaaactgcaccgggatcaaaacgcttggggaccggatgcggaagatttccgtccggaa
cggtttgaggatccttcaagtatccctcaccatgcgtataagccgtttggaaacggacag
cgcgcttgtattggcatgcagtttgctcttcaagaagcgacaatggttctcggtcttgta
ttaaagcattttgaattgataaaccatactggctacgaactaaaaatcaaagaagcatta
acgatcaagccggatgattttaaaattactgtgaaaccgcgaaaaacagcggcaatcaat
gtacagagaaaagaacaggcagacatcaaagcagaaacaaagccaaaagaaaccaaacct
aaacacggcacacctttacttgttctttttggttcaaatcttgggacagctgagggaata
gccggtgaactggctgctcaaggccgccagatgggctttacagctgaaacggctccgctt
gatgattatatcggcaagctccctgaagaaggggcagtcgtcattgtaacggcttcttat
aatggggcgccgcctgataatgctgccggatttgtagagtggctgaaagagcttgaggaa
ggccaattgaaaggtgtttcctatgcggtattcggctgcggaaaccggagctgggccagc
acgtatcagcggattccccgcctgattgatgacatgatgaaagcaaagggggcatcgcgt
ttaacagcgattggggaaggtgacgccgccgatgattttgaaagccaccgcgagtcttgg
gaaaaccgcttctggaaggaaacgatggacgcatttgatattaacgaaatagcccagaaa
gaagacaggccttcattatcgattacttttctcagtgaagcgacggaaacgccggttgct
aaagcatatggcgcgtttgaagggattgtgttagagaatcgagaactccagacagctgcc
agcacgcgttcaacccgccatattgaattggaaattccggctggtaaaacatataaagaa
ggcgatcatatcggaatcctgccaaagaacagcagggagcttgttcagcgggttctcagc
cgattcggtttgcagtccaatcatgtgataaaagtaagcggaagcgctcatatggctcat
ctgccgatggatcggccaatcaaagtagtggatttattgtcgtcctatgtagagctgcag
gaaccggcatcaaggcttcagcttcgggagctggcctcttatacagtttgtccgccgcat
caaaaagagctggaacagctcgtttcagatgatggcatttacaaagagcaggtacttgca
aaacgtcttaccatgcttgattttttagaggattatcctgcttgcgaaatgccgtttgaa
cggtttttagcacttttgccatcactaaaaccgagatactattccatttcaagctcaccg
aaagttcatgcaaatatcgtgagcatgacggtaggagttgtgaaagcctcagcatggagc
ggccgaggtgaataccggggtgtcgcctctaattatttagcagaattgaatacaggtgat
gcagcagcttgcttcattcgtacgccgcagtccggatttcagatgccgaatgatcctgaa
acgcctatgattatggtcgggccgggcacaggaattgcgccattcagaggctttattcag
gcaagatcggttttgaagaaggaaggaagcacccttggtgaagcacttttatacttcggc
tgccgccgcccggaccatgacgacctttacagagaagagctggatcaagcggaacaggac
ggtttggtcacaatccgccgatgctactcgcgcgtcgaaaacgaaccaaaaggatatgtc
cagcacttgctcaagcaagatacgcagaaattgatgacactcattgaaaaaggggctcat
atttacgtatgcggtgatggatcgcaaatggctcctgatgtagagagaactttgcgattg
gcatatgaagctgaaaaagcagcaagtcaggaagaatcagctgtatggctgcaaaagctg
caagatcaaagacgttatgtgaaagacgtttggacaggaatgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system