KEGG   Bacillus subtilis QB928: B657_27740Help
Entry
B657_27740        CDS       T02292                                 

Gene name
ruvA
Definition
(GenBank) Holliday junction DNA helicase
  KO
K03550  holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
bsq  Bacillus subtilis QB928
Pathway
bsq03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:bsq00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    B657_27740 (ruvA)
Enzymes [BR:bsq01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     B657_27740 (ruvA)
DNA repair and recombination proteins [BR:bsq03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     B657_27740 (ruvA)
    RecFOR pathway proteins
     B657_27740 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuvA_N HHH_5 RuvA_C HHH WIYLD Nup35_RRM_2 IMS_HHH 5_3_exonuc CPSase_L_D3
Motif
Other DBs
NCBI-ProteinID: AFQ58618
Position
complement(2767604..2768209)
Genome map
AA seq 201 aa AA seqDB search
MIEFVKGTIDYVSPQYIVIENGGIGYQIFTPNPFIYKERSQETIFTYHHIREDAFSLYGF
STREEKALFTKLLNVTGIGPKGALAILGSGDPGAVIQAIENEDEAFLVKFPGVGKKTARQ
IILDLKGKLADVVPEMIENLFNHEERLEKQTAETALEEALEALRVLGYAEKEIKKVLPHL
KEEIGLTTDQYVKKALQKLLK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
gtgattgaatttgttaaagggacgattgattatgtatctccccaatatattgtcatagag
aacggcggcatcggctatcagattttcacgccgaatccgtttatatataaggagagaagc
caagaaacgatttttacataccatcatatcagagaggatgctttttcgctttatggtttt
tcaacaagagaggagaaggcgctctttacaaagctgttaaacgtgaccggaattggcccg
aaaggagcacttgccatcttgggctcgggtgatcccggagcggtcatccaagcaattgaa
aatgaagatgaagcttttttggtcaagtttcctggagtaggaaagaaaaccgcacgccag
attattctagatttaaaaggaaagctggcagatgttgtgcctgaaatgattgaaaatctg
tttaatcatgaagaaaggcttgaaaagcaaacagcggaaacggctcttgaagaagcactt
gaagccctcagggttctcggatatgctgaaaaagaaatcaaaaaggtgcttcctcacctt
aaagaagaaattgggctgacaacagaccaatatgtgaaaaaagcattacaaaaactatta
aagtaa

DBGET integrated database retrieval system