KEGG   Bacillus subtilis QB928: B657_29080Help
Entry
B657_29080        CDS       T02292                                 

Gene name
mutM
Definition
formamidopyrimidine-DNA glycosidase (EC:3.2.2.23 4.2.99.18)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
bsq  Bacillus subtilis QB928
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:bsq03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2903768..2904598)
Genome map
AA seq 276 aa AA seqDB search
MPELPEVETVRRTLTGLVKGKTIKSVEIRWPNIIKRPAEPEEFARKLAGETIQSIGRRGK
FLLFHLDHYVMVSHLRMEGKYGLHQAEEPDDKHVHVIFTMTDGTQLRYRDVRKFGTMHLF
KPGEEAGELPLSQLGPEPDAEEFTSAYLKDRLAKTNRAVKTALLDQKTVVGLGNIYVDEA
LFRAGVHPETKANQLSDKTIKTLHAEIKNTLQEAIDAGGSTVRSYINSQGEIGMFQLQHF
VYGKKDEPCKNCGTMISKIVVGGRGTHFCAKCQTKK
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
gtgccggaattaccagaggttgagacggtccggcgcactctgaccgggcttgtaaaggga
aaaacaatcaaatcggtagagatcagatggccgaatatcatcaaacggcctgccgaaccg
gaggaatttgcgcgaaaactagcaggagaaacgatacagtccatcggaagacggggaaag
tttttactgtttcatttagatcattatgttatggtttctcaccttcgaatggaaggaaaa
tacggtcttcatcaagccgaggagcctgacgataaacacgtgcatgtcatattcacgatg
acggatggaacccagctccggtacagggatgtgcggaaatttggaaccatgcacttattt
aaaccgggagaagaagcgggcgagctcccgctttctcagttagggccggagccggatgca
gaagaatttacaagtgcgtatttaaaagaccggcttgcgaaaacaaaccgcgctgtcaaa
actgccctactggatcaaaaaacggtagttggactcgggaacatttatgtggatgaggct
cttttcagagcgggtgtccatcccgagacaaaagcaaatcaattatcagataaaacaatc
aaaacccttcacgctgaaatcaaaaacactctgcaggaggcgattgatgcgggcggaagc
acagtccgttcatatatcaactcccaaggggaaatcggaatgttccagctgcagcatttt
gtgtacggaaaaaaagacgagccatgcaaaaattgcggaacgatgatttcgaaaattgtc
gttggaggaagaggcacgcatttttgcgcaaagtgccagacaaaaaagtag

DBGET integrated database retrieval system