KEGG   Bacillus subtilis QB928: B657_29190Help
Entry
B657_29190        CDS       T02292                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bsq  Bacillus subtilis QB928
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Formaldehyde assimilation, ribulose monophosphate pathway
Class
Metabolism; Overview; Carbon metabolism [PATH:bsq01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:bsq01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bsq00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:bsq00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:bsq00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bsq00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:bsq00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(2918027..2918986)
Genome map
AA seq 319 aa AA seqDB search
MKRIGVLTSGGDSPGMNAAVRAVVRKAIYHDVEVYGIYNGYAGLISGKIEKLELGSVGDI
IHRGGTKLYTARCPEFKTVEGREKGIANLKKLGIEGLVVIGGDGSYMGAKKLTEHGFPCV
GVPGTIDNDIPGTDFTIGFDTALNTVIDAIDKIRDTATSHERTYVIEVMGRHAGDIALWA
GLAGGAESILIPEADYDMHEIIARLKRGHERGKKHSIIIVAEGVGSGVEFGKRIEEETNL
ETRVSVLGHIQRGGSPSAADRVLASRLGAYAVELLLEGKGGRCVGIQNNKLVDHDIIEIL
ETKHTVEQNMYQLSKELSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgaataggggtattaacgagcggcggggattccccgggaatgaacgcagcagtt
cgcgcagtagtcagaaaagcgatctatcatgacgttgaagtttacggtatttacaacgga
tacgcgggattgatcagcggaaagattgaaaagcttgaactcggatcagtaggcgatatt
atacatcgtggagggactaagctttatacggcgagatgtcctgaattcaaaacagttgaa
ggccgtgaaaaagggatagcaaacttgaagaagcttggtattgaaggccttgttgttatc
ggtggagacggttcctatatgggtgcgaaaaaattaacggaacacgggtttccatgtgta
ggtgtaccgggtacaattgataatgacattccgggcactgattttacaatcggtttcgat
acagctttaaatacagtaattgacgcaattgataagattcgcgatacagcgacttctcat
gaacgtacatatgtaatcgaagtaatgggccgtcatgccggcgatatcgcattgtgggcc
ggtcttgcagggggcgcagaatcgatcttaatccctgaggcagactatgacatgcacgaa
atcattgcccgcttaaaacgcggccacgaacgcggcaagaagcacagtattattattgtt
gccgaaggtgtaggcagcggtgttgaattcgggaaacgcattgaagaagaaacaaatctt
gaaactagggtatctgtattgggccatatccagcgcggaggttctccgagtgctgctgac
cgtgtgttggcaagccgtctcggcgcatatgcagttgaactgctgcttgaaggaaaaggc
ggacgctgtgtaggtatacaaaacaataagcttgtagaccatgatattatagaaatactt
gagacaaaacacacagttgagcaaaacatgtatcagctttcaaaagaactgtctatctaa

DBGET integrated database retrieval system