KEGG   Bacillus subtilis QB928: B657_30510Help
Entry
B657_30510        CDS       T02292                                 

Gene name
ytpA
Definition
bacilysocin synthesis phospholipase (EC:3.1.-.-)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
bsq  Bacillus subtilis QB928
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:bsq00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    B657_30510 (ytpA)
Enzymes [BR:bsq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     B657_30510 (ytpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3054101..3054880)
Genome map
AA seq 259 aa AA seqDB search
MWTWKADRPVAVIVIIHGASEYHGRYKWLIEMWRSSGYHVVMGDLPGQGTTTRARGHIRS
FQEYIDEVDAWIDKARTFDLPVFLLGHSMGGLVAIEWVKQQRNPRITGIILSSPCLGLQI
KVNKALDLASKGLNVIAPSLKVDSGLSIDMATRNEDVIEADQNDSLYVRKVSVRWYRELL
KTIESAMVPTEAFLKVPLLVMQAGDDKLVDKTMVIKWFNGVASHNKAYREWEGLYHEIFN
EPEREDVFKAARAFTDQYI
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgtggacctggaaagcagacagacctgttgccgtgattgtaatcattcacggggcaagt
gaatatcacggacgatataaatggctgattgaaatgtggcggtcttcgggttatcacgtt
gtcatgggcgatttgcctggacagggaacaacgacaagagcgagagggcatattcgctcg
tttcaagaatacattgatgaagtagatgcttggatagataaagcgcgaacctttgatctt
ccggtttttcttctaggtcacagcatgggcggtctggtcgcgattgaatgggttaaacag
caaagaaatccccggattacgggaattattttatcatcaccgtgtctcggactgcaaatt
aaagtgaataaagcgcttgatcttgcatcaaaaggcctgaatgtcatcgctccgtcactt
aaggttgattcgggattatcaattgatatggcgacgcgcaatgaggacgtcatcgaagct
gaccaaaatgattcgttatacgtcaggaaagtttctgtcagatggtacagagagctttta
aagacaattgaatcggcaatggtgccgacagaggcatttttgaaagttccgcttcttgtg
atgcaagccggtgatgacaagcttgttgacaaaacgatggtcatcaagtggtttaatggt
gttgcttctcataataaagcatacagagagtgggaagggctttaccatgagatcttcaat
gaacccgagagagaagatgtttttaaagcagcaagagcgtttactgatcaatatatttga

DBGET integrated database retrieval system