KEGG   Bacillus subtilis QB928: B657_32250Help
Entry
B657_32250        CDS       T02292                                 

Gene name
thrC
Definition
(GenBank) Threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
bsq  Bacillus subtilis QB928
Pathway
bsq00260  Glycine, serine and threonine metabolism
bsq00750  Vitamin B6 metabolism
bsq01100  Metabolic pathways
bsq01110  Biosynthesis of secondary metabolites
bsq01120  Microbial metabolism in diverse environments
bsq01230  Biosynthesis of amino acids
Module
bsq_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bsq00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    B657_32250 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    B657_32250 (thrC)
Enzymes [BR:bsq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     B657_32250 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AFQ59070
Position
complement(3245211..3246269)
Genome map
AA seq 352 aa AA seqDB search
MWKGLIHQYKEFLPVTDQTPALTLHEGNTPLIHLPKLSEQLGIELHVKTEGVNPTGSFKD
RGMVMAVAKAKEEGNDTIMCASTGNTSAAAAAYAARANMKCIVIIPNGKIAFGKLAQAVM
YGAEIIAIDGNFDDALKIVRSICEKSPIALVNSVNPYRIEGQKTAAFEVCEQLGEAPDVL
AIPVGNAGNITAYWKGFKEYHEKNGTGLPKMRGFEAEGAAAIVRNEVIENPETIATAIRI
GNPASWDKAVKAAEESNGKIDEVTDDEILHAYQLIARVEGVFAEPGSCASIAGVLKQVKS
GEIPKGSKVVAVLTGNGLKDPNTAVDISEIKPVTLPTDEDSILEYVKGAARV
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgtggaaaggacttatccatcaatataaagaatttttacctgtaacagatcaaacaccg
gcgctaactttacatgaaggaaacacacctcttattcacctgccgaagctgtctgagcag
ctcggaattgagcttcatgtcaaaacggaaggcgtcaatcctacgggatcatttaaagat
cgcggaatggttatggctgtggcaaaggcaaaagaagaaggcaatgacacgattatgtgc
gcgtcaacaggtaacacttccgctgctgcggcagcatatgcagcccgtgctaacatgaaa
tgcattgtcatcatcccgaacggaaaaattgcatttggaaaactcgctcaagctgtcatg
tacggagccgagattatcgcaattgacggaaactttgacgatgcgcttaaaattgtccgt
tccatctgtgagaaatcaccgattgcccttgtcaactcagtcaacccttaccgcattgaa
ggccaaaaaactgctgccttcgaagtgtgcgaacagctgggggaagcgcctgatgtttta
gcgatcccggtcggaaatgctggaaacatcactgcgtactggaagggcttcaaggaatat
catgagaaaaacggcacaggccttccgaaaatgcgcggctttgaagctgagggtgcggcg
gcaatcgtgcgcaatgaagtgattgaaaatccggaaacaatagcgacagccattcgtatc
ggaaacccggcaagctgggacaaagctgtaaaggcagccgaggaatccaatgggaaaatt
gacgaagtcactgatgatgaaatccttcacgcatatcagctgatcgcccgtgtagaaggc
gtgtttgcagaaccaggttcttgcgcgtctatcgcaggagtgctgaaacaggtgaaatcc
ggagaaattccgaaaggcagcaaggtcgtagctgtgttaacaggaaacggactgaaagat
ccgaacacagcggtcgacatttcagaaatcaagcctgtcacattgccgactgatgaagac
agcatccttgaatatgtaaaaggagcggcccgtgtatga

DBGET integrated database retrieval system