KEGG   Bacillus subtilis QB928: B657_35670Help
Entry
B657_35670        CDS       T02292                                 

Gene name
gtaB
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bsq  Bacillus subtilis QB928
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:bsq00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bsq00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:bsq00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bsq00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3597070..3597948
Genome map
AA seq 292 aa AA seqDB search
MKKVRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIIEEAVEAGIEDIIIVTGKS
KRAIEDHFDYSPELERNLEEKGKTELLEKVKKASNLADIHYIRQKEPKGLGHAVWCARNF
IGDEPFAVLLGDDIVQAETPGLRQLMDEYEKTLSSIIGVQQVPEEETHRYGIIDPLTSEG
RRYQVKNFVEKPPKGTAPSNLAILGRYVFTPEIFMYLEEQQVGAGGEIQLTDAIQKLNEI
QRVFAYDFEGKRYDVGEKLGFITTTLEFAMQDKELRDQLVPFMEGLLNKEEI
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagtacgtaaagccataattccagcagcaggcttaggaacacgttttcttccg
gctacgaaagcaatgccgaaagaaatgcttcctatcgttgataaacctaccattcaatac
ataattgaagaagctgttgaagccggtattgaagatattattatcgtaacaggaaaaagc
aagcgtgcgattgaggatcattttgattactctcctgagcttgaaagaaacctagaagaa
aaaggaaaaactgagctgcttgaaaaagtgaaaaaggcttctaacctggctgacattcac
tatatccgccaaaaagaacctaaaggtctcggacatgctgtctggtgcgcacgcaacttt
atcggcgatgagccgtttgcggtactgcttggtgacgatattgttcaggctgaaactcca
gggttgcgccaattaatggatgaatatgaaaaaacactttcttctattatcggtgttcag
caggtgcccgaagaagaaacacaccgctacggcattattgacccgctgacaagtgaaggc
cgccgttatcaggtgaaaaacttcgttgaaaaaccgcctaaaggcacagcaccttctaat
cttgccatcttaggccgttacgtattcacgcctgagatcttcatgtatttagaagagcag
caggttggcgccggcggagaaattcagctcacagacgccattcaaaagctgaatgaaatt
caaagagtgtttgcttacgattttgaaggcaagcgttatgatgttggtgaaaagctcggc
tttatcacaacaactcttgaatttgcgatgcaggataaagagcttcgcgatcagctcgtt
ccatttatggaaggtttactaaacaaagaagaaatctaa

DBGET integrated database retrieval system