KEGG   Bacillus subtilis QB928: B657_37100Help
Entry
B657_37100        CDS       T02292                                 

Gene name
murAB
Definition
UDP-N-acetylglucosamine1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
bsq  Bacillus subtilis QB928
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsq00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    B657_37100 (murAB)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    B657_37100 (murAB)
Enzymes [BR:bsq01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     B657_37100 (murAB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3737528..3738817)
Genome map
AA seq 429 aa AA seqDB search
MEKLNIAGGDSLNGTVHISGAKNSAVALIPATILANSEVTIEGLPEISDIETLRDLLKEI
GGNVHFENGEMVVDPTSMISMPLPNGKVKKLRASYYLMGAMLGRFKQAVIGLPGGCHLGP
RPIDQHIKGFEALGAEVTNEQGAIYLRAERLRGARIYLDVVSVGATINIMLAAVLAEGKT
IIENAAKEPEIIDVATLLTSMGAKIKGAGTNVIRIDGVKELHGCKHTIIPDRIEAGTFMI
AGAAMGKEVIIDNVIPTHLESLTAKLREMGYHIETSDDQLLIVGGQKNLKPVDVKTLVYP
GFPTDLQQPMTALLTRAKGTSVVTDTIYSARFKHIDELRRMGANMKVEGRSAIITGPVEL
QGAKVKASDLRAGACLVVAGLMADGVTEITGLEHIDRGYSSLEKKLEGLGATIWRERMTD
EEIEQLQNS
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagttgaatattgccggcggtgactcgttaaacggtacagtacatatcagcggc
gctaaaaacagcgctgttgcgttaatacctgcaaccattttggcaaattccgaggtgaca
attgaagggcttccagagatttcagatattgaaacgctgcgtgacctgttaaaggaaatc
ggcggcaacgtgcattttgagaatggggaaatggttgttgaccctacgtcgatgatcagc
atgccgcttcctaacgggaaagtaaaaaagcttcgcgcgtcatattatttaatgggggcg
atgctcggccgcttcaagcaggcggtcattggattgcctggcggctgtcacttagggccc
cgtccgattgatcagcatatcaaaggctttgaagcactcggagctgaagtaaccaatgaa
caaggcgccatttatttgcgagctgaaaggctgagaggcgcacggatttatttagatgtc
gtaagcgttggggcaacgattaacattatgctcgccgctgttttggcagaagggaaaacg
atcatcgaaaacgctgccaaggagcctgagatcattgacgtcgcgacattgcttaccagc
atgggcgccaaaatcaaaggtgcgggcaccaatgtgattcgaatcgacggcgtgaaggaa
ctgcacggctgcaagcatacgatcattccggacagaattgaagccgggacatttatgatt
gcaggggctgcaatgggcaaggaagtcattatcgataacgtcatccctactcatcttgag
tcgttaacggcaaagctgagagaaatgggctatcatatcgaaacaagcgacgaccagctc
ctcattgtcggcgggcagaagaacttaaagccggttgacgtcaaaaccctcgtatacccg
gggtttccgactgatttacagcagccgatgacggcgctcctgacaagggcgaaagggacg
agtgtcgtcacagacaccatctactcggcaagattcaagcacattgatgagctgagacga
atgggtgccaatatgaaagtagaaggcagatctgccatcatcacaggtcctgtcgagctt
caaggcgcaaaagtgaaggcgagtgatctgcgtgccggagcctgcttggtggtagccgga
ctgatggctgatggcgtcacggaaattacgggactggagcatattgaccgaggatacagc
agccttgagaagaagcttgaggggcttggagcgacaatttggcgtgaaagaatgactgac
gaagaaatagaacagcttcaaaattcataa

DBGET integrated database retrieval system