KEGG   Bacillus subtilis QB928: B657_37810Help
Entry
B657_37810        CDS       T02292                                 

Gene name
spsL
Definition
nucleotide sugar epimerase (EC:5.1.3.-)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
bsq  Bacillus subtilis QB928
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bsq00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    B657_37810 (spsL)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    B657_37810 (spsL)
Enzymes [BR:bsq01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     B657_37810 (spsL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3814211..3814666)
Genome map
AA seq 151 aa AA seqDB search
MIDGVKVKKLMKHSDDRGFFAELVRDDENLLEHFGQASWSKSYPGVIKAFHYHEKQDDLW
FFPTGHAQVVLYDLREDSKTKGETDVYYMGEDNPMLLLIPKGVAHGYRVLGETPLTIIYF
TTMSYNPDQPDEKRIPWDDETIGFNWNTEFR
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
gtgattgatggagtcaaggtgaaaaaattgatgaagcatagcgatgacagaggctttttt
gctgagctggtccgggacgatgagaatctccttgagcattttgggcaggcctcttggtcg
aaaagctatccgggtgtgattaaggcatttcattatcatgagaagcaggatgatctctgg
ttcttcccaaccggccacgctcaggttgtcctatacgatcttcgagaggattcaaagaca
aaaggagaaacggacgtctattatatgggcgaagacaacccgatgctgttattaatccca
aaaggggtggctcacggatatagagtgctgggagagacgccgctgacaattatctatttt
accaccatgtcgtataacccggatcagcctgatgaaaaaagaattccgtgggatgatgag
acgatcggttttaactggaacactgaattcagataa

DBGET integrated database retrieval system