KEGG   Bacillus subtilis QB928: B657_39920Help
Entry
B657_39920        CDS       T02292                                 

Gene name
asnH
Definition
asparagine synthase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
bsq  Bacillus subtilis QB928
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bsq00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    B657_39920 (asnH)
Enzymes [BR:bsq01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     B657_39920 (asnH)
Peptidases [BR:bsq01002]
 Cysteine Peptidases
  Family C44
   B657_39920 (asnH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4030158..4032401
Genome map
AA seq 747 aa AA seqDB search
MCGLAGIINLAAPRSQECTFHILKGMADAISYRGPDDEQYHIDSKVGFAFRRLSILDLVN
GQQPFLNEDGSIVVMVNGEIYNYKELKASLHNHMFKTTSDCEVIVHLYEEKGIGFVDDII
GMFSIAIWDKNKNKVFLVRDRFGIKPLFYTELKHELIFASEIKSLFSHPHCPRQFNWKEA
LSDIWLSGEAASNHKETTSFFVNIQNLDAGHYLEINLTTNERKTASYWSLQDILLRQGYR
ENLHPDDLIEGYRELLADSVHRCLQSDVEVGLFLSGGIDSAAVAHFAAEKQDLHTFTVLS
QSTFTNEDAKYAHWLAKDLHLPNHQVLYQLGNDELLQPESYKHLLWICETPFCGPEQLYK
FHLHKYAKAIRPNLKVMLTGQGSDEFNGGYSTTLSPAENPSWEGFIESVNTMEMNRLHRL
QGNIFRVWEEHFGLSPINLSYLKSNDSSQADPWQSYVLTKYRDLQMYNCWHEDRIAAANH
IENRVPFLDHRLVEWVCGIPDGLRKDLLWDKSVLRKSLTNELHTSYTHRPKVPFFYGKDV
RYTHKMMFHLLKKNNYQLIEEAFSHSDASSIIQVEHIHAIMTYLEDDPEFTNFEFLLRLV
NMGLLSKMTKETPSVQLDITSHLESITIKDWHSQEGDIASRLNISANKCEGQDILALNPG
VTLLRPESDSEHCIYIAEEGFIQFIVSEEDVGAWLHILCDINGKDTLHTILDRHGVSLEE
VAKYIQEAIEHNIILIKQKNLPEGAYR
NT seq 2244 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgggctcgcgggtattataaatctggctgctccccgttctcaggaatgtaccttt
catatattgaaaggcatggcagatgccatcagctataggggaccggatgatgaacaatat
catattgattccaaagtcggctttgcatttcggcgattgtccattcttgaccttgtaaat
ggacagcagccctttttaaatgaggatggatcaatcgtcgttatggtaaatggagaaatt
tataactataaagaactgaaggcttctttacacaatcatatgtttaaaacgacatctgat
tgtgaagtaattgttcatttatatgaagaaaaagggattggatttgtagacgacatcatc
ggaatgttttcaatagccatttgggacaaaaataaaaacaaagtatttttagttcgtgac
cgctttgggattaaaccgcttttttacacagagctaaaacacgagcttatatttgcctct
gaaataaaatccctattttctcatcctcactgtccccgccaatttaattggaaagaagca
ctctcagacatttggctaagcggggaagcagccagtaatcataaagaaaccacttccttt
tttgtaaacatccaaaatctcgatgctggccattatctcgaaattaatttgacaacaaat
gaacgaaaaacagcaagctattggtctttacaggatattttgctcaggcaaggctatcgt
gagaatctccatcccgatgacctgattgaaggatatagagaactgctggcagattcagtc
catagatgtttacaaagcgacgttgaagtcgggttgtttcttagcggtggcattgattca
gctgcagtcgcacattttgctgcagaaaaacaggatctccatacgtttacagtattaagc
caaagtacatttacaaatgaagatgcaaaatatgcccattggctggctaaagatttacac
cttccaaatcatcaggttctctatcaattagggaacgatgagttattacaaccagagtca
tataaacatttgttatggatctgtgaaacaccgttttgcggaccggaacaattatataag
tttcatttacataagtatgccaaagcgataaggccaaacctgaaagtcatgctgaccggc
cagggcagcgacgaatttaacggcggttacagcacgacactttcaccagccgagaaccca
agttgggaaggatttattgaatcggtcaatacgatggagatgaaccggctgcatcggctg
cagggaaatatctttagagtgtgggaggagcattttggactttctcctataaacctttct
tatttaaagagcaatgattccagccaagcagatccttggcaatcgtatgtcctgacaaaa
taccgtgatctgcaaatgtataattgctggcatgaagatcggatcgccgcggctaatcat
atcgaaaaccgtgtaccgttcttggaccatcggcttgttgaatgggtttgcggaatacct
gatggactccgtaaagacttgttatgggataagtcggtattgcgaaaatcattaacaaat
gagctgcatacaagctatacccaccggccaaaggttccttttttctatggtaaggacgtg
agatatacacataaaatgatgtttcatcttctgaagaaaaacaattatcagcttatagag
gaggccttctctcacagcgatgcctccagcataatacaggttgaacacattcatgccatc
atgacatatttggaggatgatcctgagtttacaaattttgaatttttattaagactggtg
aacatgggacttttatcaaaaatgactaaagaaaccccttctgttcaattagacataacc
agccatttagaatcgataacaataaaagactggcactcacaggaaggtgatattgccagt
cgtttaaatatctcagccaataagtgtgaaggacaagatattttggcgctaaaccctggc
gtcactctgttaaggccggaaagcgatagtgagcattgcatctacattgcggaagaagga
tttattcagtttattgtttcggaggaagacgtcggagcttggctgcatattctctgcgat
attaatggaaaagacacacttcatacgattttagacagacatggtgtcagccttgaagaa
gtggccaaatatattcaagaagccatcgaacacaatatcattttgatcaaacaaaaaaat
ctgccagaaggagcatatagatga

DBGET integrated database retrieval system