KEGG   Bacillus subtilis QB928: B657_40320Help
Entry
B657_40320        CDS       T02292                                 

Gene name
argI
Definition
(GenBank) Arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
bsq  Bacillus subtilis QB928
Pathway
bsq00220  Arginine biosynthesis
bsq00330  Arginine and proline metabolism
bsq01100  Metabolic pathways
bsq01110  Biosynthesis of secondary metabolites
bsq01130  Biosynthesis of antibiotics
bsq01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bsq00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    B657_40320 (argI)
   00330 Arginine and proline metabolism
    B657_40320 (argI)
Enzymes [BR:bsq01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     B657_40320 (argI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase SHOCT
Motif
Other DBs
NCBI-ProteinID: AFQ59889
Position
complement(4072943..4073833)
Genome map
AA seq 296 aa AA seqDB search
MDKTISVIGMPMDLGQARRGVDMGPSAIRYAHLIERLSDMGYTVEDLGDIPINREKIKND
EELKNLNSVLAGNEKLAQKVNKVIEEKKFPLVLGGDHSIAIGTLAGTAKHYDNLGVIWYD
AHGDLNTLETSPSGNIHGMPLAVSLGIGHESLVNLEGYAPKIKPENVVIIGARSLDEGER
KYIKESGMKVYTMHEIDRLGMTKVIEETLDYLSACDGVHLSLDLDGLDPNDAPGVGTPVV
GGISYRESHLAMEMLYDAGIITSAEFVEVNPILDHKNKTGKTAVELVESLLGKKLL
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atggataaaacgatttcggttattggaatgccaatggatttaggacaagcacgacgcgga
gtggatatgggcccgagtgccatccggtacgctcatctgatcgagaggctgtcagacatg
gggtatacggttgaagatctcggtgacattccgatcaatcgcgaaaaaatcaaaaatgac
gaggaactgaaaaacctgaattccgttttggcgggaaatgaaaaactcgcgcaaaaggtc
aacaaagtcattgaagagaaaaaattcccgcttgtcctgggcggtgaccacagtattgcg
atcggcacgcttgcaggcacagcgaagcattacgataatctcggcgtcatctggtatgac
gcgcacggcgatttgaatacacttgaaacttcaccatcgggcaatattcacggcatgccg
ctcgcggtcagcctaggcattggccacgagtcactggttaaccttgaaggctacgcgcct
aaaatcaaaccggaaaacgtcgtcatcattggcgcccggtcacttgatgaaggggagcgc
aagtacattaaggaaagcggcatgaaggtgtacacaatgcacgaaatcgatcgtcttggc
atgacaaaggtcattgaagaaacccttgattatttatcagcatgtgatggcgtccatctg
agccttgatctggacggacttgatccgaacgacgcaccgggtgtcggaacccctgtcgtc
ggcggcatcagctaccgggagagccatttggctatggaaatgctgtatgacgcaggcatc
attacctcagccgaattcgttgaggttaacccgatccttgatcacaaaaacaaaacgggc
aaaacagcagtagagctcgtagaatccctgttagggaagaagctgctgtaa

DBGET integrated database retrieval system