KEGG   Bacillus subtilis subsp. subtilis RO-NN-1: I33_0020Help
Entry
I33_0020          CDS       T01837                                 

Definition
Dck
Orthology
K15519  
deoxyadenosine/deoxycytidine kinase [EC:2.7.1.76 2.7.1.74]
Organism
bsr  Bacillus subtilis subsp. subtilis RO-NN-1
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:bsr00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:bsr00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(22429..23082)
Genome map
AA seq 217 aa AA seqDB search
MKEHHIPKNSIITVAGTVGVGKSTLTKTLAKRLGFKTSLEEVDHNPYLEKFYHDFERWSF
HLQIYFLAERFKEQKTIFEAGGGFVQDRSIYEDTGIFAKMHADKGTMSKVDYKTYTSLFE
AMVMTPYFPHPDVLIYLEGDLENILNRIEQRGREMELQTSRSYWEEMHTRYENWISGFNA
CPVLKLRIEDYDLLNDENSIENIVDQIASVIHDNQKK
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaacatcatatccctaagaattcaattattacagtagcaggaacagtaggtgtc
ggaaaatcgactttaacaaaaactttagctaaacggcttggatttaaaacatctttggag
gaagtcgatcataatccatacttggaaaagttctatcatgattttgaacgttggagcttt
caccttcaaatttatttcttagctgaacgcttcaaagaacagaaaacaatttttgaagcc
ggcggaggttttgtacaggatcgttcgatttatgaagatacaggaattttcgcaaaaatg
catgctgataaagggacaatgtcaaaggttgattataagacttacacaagccttttcgaa
gcaatggtaatgacaccgtatttcccacacccagatgtgttgatctatttagaaggagat
ctggagaacattttaaaccggattgaacaacgcggccgtgagatggagcttcagacaagt
cggtcttattgggaagaaatgcatacacgctacgagaactggataagcggttttaatgcc
tgccctgttttaaaacttcgcattgaagattatgatcttctgaacgacgaaaactcgatt
gaaaatattgtagatcaaattgcttcagttattcatgataatcaaaaaaagtga

DBGET integrated database retrieval system