KEGG   Bacillus subtilis subsp. subtilis RO-NN-1: I33_0091Help
Entry
I33_0091          CDS       T01837                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
bsr  Bacillus subtilis subsp. subtilis RO-NN-1
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bsr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    I33_0091 (folP)
Enzymes [BR:bsr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     I33_0091 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
85594..86451
Genome map
AA seq 285 aa AA seqDB search
MAQHTIDQTQVIHTKPSALSYKEKTLVMGILNVTPDSFSDGGKYDSLDKALLHAKEMIDD
GAHIIDIGGESTRPGAECVSEDEEMSRVIPVIERITKELGVPISVDTYKASVADEAVKAG
ASIINDIWGAKHDPKMASVAAEHNVPIVLMHNRPERNYNDLLPDMLSDLMESVKIAVEAG
VDEKNIILDPGIGFAKTYHDNLAVMNKLEIFSGLGYPVLLATSRKRFIGRVLDLPPEERA
EGTGATVCLGIQKGCDIVRVHDVKQIARMAKMMDAMLNKGGVHHG
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagcacacaatagatcaaacacaagtaatccacactaagcccagcgctttatca
tataaagagaagacgctggtgatgggaattttaaacgtaacgccagactctttctcggat
ggcggaaaatatgacagcttggacaaggcgctgctgcacgcgaaagagatgatcgatgat
ggtgcccatatcattgatatcggaggtgaatcaacaaggcctggcgctgagtgcgtgtct
gaggatgaggagatgtccagagtcattccggtgattgagcggattacgaaagagcttggt
gttcctatttctgtagatacgtacaaggcttctgtcgcagatgaagcagtgaaagccggt
gcatccattatcaatgatatttggggagccaaacatgatccgaagatggcttccgttgca
gctgaacataatgttccaattgtactcatgcataaccgccctgaaagaaactacaatgac
ttattgccggatatgctgtcggacttaatggagagtgtaaaaattgctgttgaggccgga
gtagacgagaagaacattattctcgatcccggtatcggtttcgcgaaaacctatcacgat
aacttggcagtgatgaacaaactagagattttcagcggattgggatatccggttcttctg
gcaacctcccgaaaaagattcatcggacgtgttctggatcttccgcctgaggagcgggct
gagggcacaggcgcgactgtgtgtctcggcattcaaaaaggctgtgacattgtcagggtc
catgatgtaaagcaaattgccagaatggcgaaaatgatggacgcgatgctgaataaggga
ggggtgcaccatggataa

DBGET integrated database retrieval system