KEGG   Bacillus subtilis subsp. subtilis RO-NN-1: I33_0093Help
Entry
I33_0093          CDS       T01837                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
bsr  Bacillus subtilis subsp. subtilis RO-NN-1
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bsr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    I33_0093 (folK)
Enzymes [BR:bsr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     I33_0093 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
86803..87306
Genome map
AA seq 167 aa AA seqDB search
MNNIAYIALGSNIGDRETYLRQAVALLHQHAAVTVTKVSSIYETDPVGYEDQAEFLNMAI
EIKTSLNPFELLELTQQIENELGRTREVRWGPRTADLDILLFNRENIETEQLIVPHPRMY
ERLFVLAPLAEICQQVEKEATSAETDQEGVRVWKQKSGVDEFVHSES
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgaacaacatagcttatattgcacttggatctaatattggagatagagaaacgtattta
aggcaagcagtggctttactgcatcagcatgctgcggtgacagtcactaaagtgtcgtct
atttacgaaactgacccggtcggatacgaagatcaagctgaatttttgaatatggctatt
gaaatcaagacatcactgaacccttttgaactccttgaactgactcagcagatagaaaat
gaattaggcagaacaagggaagtaagatgggggccgcggacggcagaccttgacattttg
ttatttaatcgtgaaaatattgaaacagagcaactaattgttccgcatccgagaatgtat
gagcgtttgtttgtccttgcaccgcttgcggaaatttgccagcaggttgaaaaagaggct
acaagcgccgaaacagaccaagaaggtgtaagagtatggaagcagaaatctggggtagac
gaattcgtgcattcagaaagctga

DBGET integrated database retrieval system