KEGG   Bacillus subtilis subsp. subtilis RO-NN-1: I33_0122Help
Entry
I33_0122          CDS       T01837                                 

Gene name
gltX
Definition
glutamyl-tRNA synthetase (EC:6.1.1.24)
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
bsr  Bacillus subtilis subsp. subtilis RO-NN-1
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:bsr00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
110909..112360
Genome map
AA seq 483 aa AA seqDB search
MGNEVRVRYAPSPTGHLHIGNARTALFNYLFARNQGGKFIIRVEDTDKKRNIEGGEQSQL
NYLKWLGIDWDESVDVGGEYGPYRQSERNDIYKVYYEELLEKGLAYKCYCTEEELEKERE
EQIARGEMPRYSGKHRDLTQEEQEKFIAEGRKPSIRFRVPEGKIIAFNDIVKGEISFESD
GIGDFVIVKKDGTPTYNFAVAIDDYLMKMTHVLRGEDHISNTPKQIMIYQAFGWDIPQFG
HMTLIVNESRKKLSKRDESIIQFIEQYKELGYLPEALFNFIGLLGWSPVGEEELFTKEQF
IEIFDVNRLSKSPALFDMHKLKWVNNQYVKKLDLDQAVELTLPHLQKAGKVGTELSAEEQ
EWVRKLISLYHEQLSYGAEIVELTDLFFTDEIEYNQEAKAVLEEEQVPEVLSTFAAKLEE
LEEFTPDNIKASIKAVQKETGHKGKKLFMPIRVAVTGQTHGPELPQSIELIGKETAIQRL
KNI
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgggaaacgaagtacgcgtccgttatgcaccaagtccaaccggacatttgcatattgga
aatgccagaacggcgctttttaattatttatttgcccgcaatcaaggcggtaagtttatc
attcgagttgaggatacagataaaaagcgcaatattgagggcggagaacaaagccagctg
aattatctgaagtggctaggtattgactgggatgagagtgtggatgtcggaggagagtac
ggtccataccgtcagtcagagcgtaacgatatctataaagtgtactatgaagagcttctt
gaaaaagggcttgcttataaatgttactgtacggaagaagagcttgaaaaagagcgtgaa
gaacagatcgcccgcggagaaatgcctcgttattccggaaaacacagagacctgactcag
gaagaacaggagaaatttatcgctgaaggcagaaaaccgagtattcgtttccgcgtgccg
gaaggaaaaatcatcgccttcaatgatatcgtaaaaggcgaaatttcttttgaatcagat
ggcatcggcgactttgttattgtgaaaaaggacggaacgccaacttacaacttcgcggta
gcgattgatgactacttaatgaaaatgacacacgtgctccgcggtgaggatcatatttct
aacacaccgaaacagattatgatttatcaagcattcggatgggatattcctcagttcggg
cacatgacgctgatcgtaaacgaaagccgtaaaaagctcagtaaacgtgatgaatccatt
attcaattcatcgagcagtacaaagagcttgggtacctgccagaagcgctgttcaacttt
atcggcctgttaggctggtcaccggttggagaagaagagcttttcacaaaagagcagttt
attgaaatttttgatgtaaatcgtttatctaaatcaccagctttgtttgatatgcataag
ctaaaatgggttaacaaccaatatgtgaagaagctggatcttgatcaggctgttgaattg
acgcttccgcatttgcaaaaagccggcaaagttggcactgagctttctgctgaagaacaa
gaatgggttcgtaaactgatttccctgtatcatgagcaattaagctacggtgcggaaatt
gttgagctgactgatttgttctttacggatgagatcgagtataatcaagaagcgaaagct
gttctggaagaagaacaggttcctgaagtgctcagcacattcgctgcgaagcttgaagag
cttgaggagttcactccggataacatcaaagcatcgatcaaagcagtgcagaaagaaact
ggccataaagggaaaaaactgtttatgccgattcgtgttgctgtaacagggcaaactcac
ggtccggaactgccgcaatcaattgaattgatcggtaaagagactgcaattcagcgtttg
aagaatatctaa

DBGET integrated database retrieval system