KEGG   Bacillus subtilis subsp. subtilis RO-NN-1: I33_0373Help
Entry
I33_0373          CDS       T01837                                 

Definition
uroporphyrin-III C-methyltransferase (EC:2.1.1.107)
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
bsr  Bacillus subtilis subsp. subtilis RO-NN-1
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:bsr00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(343855..345300)
Genome map
AA seq 481 aa AA seqDB search
MKNGIVYFVGAGPGDPGLLTIKGKQALEEADVILYDRLANPKLLEFASPDCQFIYCGKLP
DRHFMKQKEINALLVEKALNGLTVVRLKGGDPSVFGRVGEEADALHEHGILYEMVPGITS
GIAAPLYAGIPVTHRDFASSFAMITAHDKSLKGTPNLNWEGLARSVQTLVFYMGVKNLSY
ICQQLISYGKSLSVPVIVIQWGTWGRQRSVKGTLENIQQKVQEHQITNPAIIVIGDIVNF
QTHGWFESKPLIGRHLMVVTHGEDEDPLADKLRDSGADVIEWPKWRTENMPVNEDILRKI
GTFEDVFFTSRRAVCEFFRALASQKIDIRQLTAKLSAASEQAKTELEKRGFLVTAIQPDS
EKRLVVGSRHAVENMQKHESCWFYITHENVIDDRFTHMIQRTISESPLHMVICPNKLSVQ
QLISGGEQIGILPEPSASRPPIVCIGDDSAAGAYGFTAVQEQDELFAFIQNQQTQKKLLH
S
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgaagaacggaatcgtatatttcgtgggagccggacccggcgacccaggactgctcacc
atcaaaggaaaacaggcgctcgaggaagcagatgtgattttatatgaccggctcgccaac
ccgaagctgctcgaatttgcatcaccggactgccagtttatttattgcggaaaactgcca
gaccgccattttatgaaacaaaaagaaattaacgccctgctggttgaaaaagcattaaat
gggttaaccgtcgttcgcttgaagggcggagatccgagcgtattcggcagagtcggcgag
gaagcagatgctcttcatgagcacggcattctctatgaaatggtgccgggaattacctct
ggaattgcagcgccgctatatgcgggcatccccgtcacgcatcgggattttgcatcgtct
tttgccatgattacagcgcatgataaatcattaaaaggcacgccgaaccttaactgggaa
gggcttgcacgaagcgtacaaacccttgttttttacatgggtgtcaagaacttgtcttat
atttgccagcagcttatttcatacgggaaatcgctttctgtccctgtcattgtcatccaa
tggggaacgtggggccgccagcggagtgtgaaaggaacacttgagaacattcagcaaaaa
gtgcaggaacaccagattacaaaccctgcgattatcgtcatcggagacatcgtcaacttt
caaacacacggctggtttgaaagcaaaccgctcatcggacggcatttgatggttgtgact
catggcgaagatgaagacccgcttgcagacaagctgcgcgattccggcgccgatgtcatc
gagtggccgaaatggcggaccgaaaacatgcctgtcaatgaagacattcttcgaaagatt
ggcacctttgaagacgtttttttcacatcgcgccgggcggtttgtgaatttttcagagca
ctggcttctcagaaaatcgacatccgccagctgacagccaaactgagtgcagcatctgag
caagcaaagacagagcttgagaaacggggctttcttgtcaccgccattcagcctgattca
gagaaacgtcttgttgtcgggagccgccatgcagtggaaaacatgcaaaagcatgaatcc
tgttggttttatatcactcatgaaaacgtcatagatgaccggttcacccacatgattcag
cgtaccatcagtgaatccccgctgcacatggtcatttgcccgaacaagctgtccgttcag
caattgatcagtggtggtgaacaaattggcattttgccggaaccgtcagcaagccggcct
cctatcgtctgtataggcgatgactcagctgccggggcttatggattcacagccgtccaa
gaacaagatgaattgttcgctttcattcagaatcaacagacgcagaaaaagctccttcac
agctga

DBGET integrated database retrieval system