KEGG   Bacillus subtilis subsp. subtilis RO-NN-1: I33_0373Help
Entry
I33_0373          CDS       T01837                                 

Definition
uroporphyrin-III C-methyltransferase (EC:2.1.1.107)
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
bsr  Bacillus subtilis subsp. subtilis RO-NN-1
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bsr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    I33_0373
Enzymes [BR:bsr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     I33_0373
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     I33_0373
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(343855..345300)
Genome map
AA seq 481 aa AA seqDB search
MKNGIVYFVGAGPGDPGLLTIKGKQALEEADVILYDRLANPKLLEFASPDCQFIYCGKLP
DRHFMKQKEINALLVEKALNGLTVVRLKGGDPSVFGRVGEEADALHEHGILYEMVPGITS
GIAAPLYAGIPVTHRDFASSFAMITAHDKSLKGTPNLNWEGLARSVQTLVFYMGVKNLSY
ICQQLISYGKSLSVPVIVIQWGTWGRQRSVKGTLENIQQKVQEHQITNPAIIVIGDIVNF
QTHGWFESKPLIGRHLMVVTHGEDEDPLADKLRDSGADVIEWPKWRTENMPVNEDILRKI
GTFEDVFFTSRRAVCEFFRALASQKIDIRQLTAKLSAASEQAKTELEKRGFLVTAIQPDS
EKRLVVGSRHAVENMQKHESCWFYITHENVIDDRFTHMIQRTISESPLHMVICPNKLSVQ
QLISGGEQIGILPEPSASRPPIVCIGDDSAAGAYGFTAVQEQDELFAFIQNQQTQKKLLH
S
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgaagaacggaatcgtatatttcgtgggagccggacccggcgacccaggactgctcacc
atcaaaggaaaacaggcgctcgaggaagcagatgtgattttatatgaccggctcgccaac
ccgaagctgctcgaatttgcatcaccggactgccagtttatttattgcggaaaactgcca
gaccgccattttatgaaacaaaaagaaattaacgccctgctggttgaaaaagcattaaat
gggttaaccgtcgttcgcttgaagggcggagatccgagcgtattcggcagagtcggcgag
gaagcagatgctcttcatgagcacggcattctctatgaaatggtgccgggaattacctct
ggaattgcagcgccgctatatgcgggcatccccgtcacgcatcgggattttgcatcgtct
tttgccatgattacagcgcatgataaatcattaaaaggcacgccgaaccttaactgggaa
gggcttgcacgaagcgtacaaacccttgttttttacatgggtgtcaagaacttgtcttat
atttgccagcagcttatttcatacgggaaatcgctttctgtccctgtcattgtcatccaa
tggggaacgtggggccgccagcggagtgtgaaaggaacacttgagaacattcagcaaaaa
gtgcaggaacaccagattacaaaccctgcgattatcgtcatcggagacatcgtcaacttt
caaacacacggctggtttgaaagcaaaccgctcatcggacggcatttgatggttgtgact
catggcgaagatgaagacccgcttgcagacaagctgcgcgattccggcgccgatgtcatc
gagtggccgaaatggcggaccgaaaacatgcctgtcaatgaagacattcttcgaaagatt
ggcacctttgaagacgtttttttcacatcgcgccgggcggtttgtgaatttttcagagca
ctggcttctcagaaaatcgacatccgccagctgacagccaaactgagtgcagcatctgag
caagcaaagacagagcttgagaaacggggctttcttgtcaccgccattcagcctgattca
gagaaacgtcttgttgtcgggagccgccatgcagtggaaaacatgcaaaagcatgaatcc
tgttggttttatatcactcatgaaaacgtcatagatgaccggttcacccacatgattcag
cgtaccatcagtgaatccccgctgcacatggtcatttgcccgaacaagctgtccgttcag
caattgatcagtggtggtgaacaaattggcattttgccggaaccgtcagcaagccggcct
cctatcgtctgtataggcgatgactcagctgccggggcttatggattcacagccgtccaa
gaacaagatgaattgttcgctttcattcagaatcaacagacgcagaaaaagctccttcac
agctga

DBGET integrated database retrieval system