KEGG   Bacillus subtilis subsp. subtilis RO-NN-1: I33_0392Help
Entry
I33_0392          CDS       T01837                                 

Definition
beta-glucosidase (EC:3.2.1.21)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
bsr  Bacillus subtilis subsp. subtilis RO-NN-1
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:bsr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    I33_0392
Enzymes [BR:bsr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     I33_0392
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
361801..363234
Genome map
AA seq 477 aa AA seqDB search
MIHRHPESFPKHFLWGSASAAYQIEGAWNEDGKGPSVWDVFTKIPGKTFKGTNGDIAVDH
YHRFKEDVALMAEMGLKAYRFSVSWPRIFPKGKGEINEAGLAFYDRLIDELLSHHIEPVL
TLYHWDLPQALMDEYGGFESRNIIEDFNHYCITLYKRFGDRVKYWVTLNEQNYNFNHGFI
TAMHPPGVKDRKRFYEANHIAFLANAKAIESFREYVPEGKIGPSFAYSPAYPLSSHPEDI
LAFENAEEFTNNWWLDMYCWGTYPQIPFRYLEKQGWAPTIEAGDMDLLAKGKPDFVGVNY
YQTITYERNPLDGVSEGKMNTTGHKGTNQETGIPGVFKTKKNPHLTTSNWDWTIDPIGLR
IGLRRITSRYQLPVFITENGLGEFDKVEDGTVQDDYRIDYLHSHLEQCRQAISDGVDLIG
YCSWSFTDLLSWLNGYQKRYGFVYVNRDEESTYDLKRLKKKSFYWYQDVIKTNGESL
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgatccaccggcatccagaatcttttccgaaacattttttgtggggctctgcttctgca
gcgtaccagattgaaggcgcttggaatgaagatggcaaaggcccttctgtttgggatgtg
tttacgaaaataccgggcaaaacgtttaaaggaaccaatggcgacattgcggttgaccat
tatcaccgatttaaagaagatgtcgctctgatggctgagatggggttaaaagcgtatcga
ttttccgtcagctggccacggatttttccaaaaggaaaaggagagatcaatgaagcaggt
ctagcgttttacgatagactgattgatgaattgctttctcatcacatcgagccggttctg
actttatatcactgggatttgcctcaagcgcttatggacgaatacggcgggtttgaatcc
agaaacatcatagaggattttaatcactactgtattactctttataaacgttttggagac
agggtgaaatattgggttacgttaaacgaacagaactacaattttaatcacggatttatt
acagccatgcatccgcctggagtgaaagacagaaaacgattttacgaagcaaaccatatt
gcgtttctggctaatgcaaaagccatcgaatcatttagagaatatgtgcctgaaggcaaa
ataggtcctagctttgcttattctccggcttaccctttatcaagccatccagaggatata
ctggcatttgaaaacgccgaagaatttacgaacaattggtggcttgacatgtattgctgg
ggaacctacccgcaaattccattccgctacctggaaaaacagggatgggcgccgacaatt
gaagcaggagatatggacctgcttgccaaagggaagcctgattttgtaggtgtcaattat
tatcagacgatcacctatgaacgaaatccgcttgatggtgtgtctgaagggaaaatgaat
acgacaggccataagggaaccaatcaggagacggggatacccggagtgttcaaaacgaaa
aaaaatccgcatctgacaacgagcaactgggattggacaattgacccaattgggctgcgt
atcggtcttcgccgaattacaagccgctatcagcttccagtgtttataacagagaacggt
ttgggtgaatttgataaagttgaggacggcactgtacaggatgattatcgaattgattat
ttgcattcgcatcttgagcaatgcagacaagccatcagtgacggtgtcgatttaatcggc
tattgcagctggtcgtttactgatctgttaagctggctgaacggctaccaaaaaagatac
ggatttgtatatgtcaatcgtgatgaagaaagcacatacgatttaaaacgcttgaagaaa
aaaagcttttattggtaccaagatgtcatcaagacgaacggagaaagtttataa

DBGET integrated database retrieval system