KEGG   Bacillus subtilis subsp. subtilis RO-NN-1: I33_0672Help
Entry
I33_0672          CDS       T01837                                 

Definition
beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
bsr  Bacillus subtilis subsp. subtilis RO-NN-1
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bsr00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
617728..618912
Genome map
AA seq 394 aa AA seqDB search
MKELGHNSFRMSISWSRLIPNGTGEINDKAANFYNNVIDALIANGIEPFVNLFHFDMPMA
LQKIGGWVNRETVDAYENYARTCFRLFGGRVKKWFTHNEPIVPVEGGYLYDFHYPNKVDF
KEAVQVGFHTMLSSARAIQAYREMKQDGKIGIILNLTPSYPRSSHPADVKAGEIADSFFN
RSFLDPSVKGDFPKELVDILKHEGFMPDYNAEDLDIIKKNTVDLLGVNYYQPRRVKAKEH
LPNPDAPFLPDRYFDPYVMPGRKMNPHRGWEIYEKGVYDILINLKENYGNIECFISENGM
GVEGEERFRDEQGIIQDDYRIEFIKEHLKWIHRAIQEGSNVKGYHLWTFMDNWSWTNAYK
NRYGFVSVNLEKGGERTIKKSGKWFKTVAEQNGF
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaaggagcttggccacaactcgttccggatgtcgatttcctggtcacgtttaatacca
aacggaacgggcgagatcaacgataaagccgcaaatttctataacaatgtcattgatgcg
ttgatcgctaacggaattgaaccttttgtcaatttgtttcatttcgatatgccgatggcg
cttcaaaaaatcggcggctgggtaaacagagagacggttgacgcgtatgaaaactatgca
agaacttgcttccgtttgtttggcggcagggtgaaaaaatggttcacgcataacgaacca
atcgttcccgtagaaggcggatacctatatgattttcattatccaaacaaggtcgacttt
aaagaggccgtccaggttggatttcatacgatgctatcaagtgcccgcgccattcaggct
tacagggagatgaagcaggacggaaaaatcggcatcatcttaaatttgaccccttcatac
ccgagaagcagccatccggcggatgtgaaagccggggaaatcgcagactcgttttttaac
agatcctttttagacccatccgtcaaaggcgattttcccaaagagctggttgacattttg
aagcatgaaggctttatgccagattacaacgctgaagatcttgacatcatcaaaaagaac
acggttgacctgttgggagtgaattattaccagccgagacgtgtgaaagcgaaagaacat
cttccgaatcccgacgctccttttttgccggacagatattttgatccctacgtcatgccg
ggccgcaaaatgaatccgcatcgcggctgggagatttatgaaaaaggcgtttatgatatt
ttgatcaatttaaaagaaaactacggcaacatcgagtgttttatctctgaaaacggcatg
ggggttgaaggtgaagagcgcttcagggatgaacaaggcatcattcaagatgattaccgg
atcgaatttataaaagagcacctcaaatggattcaccgcgccatacaggaaggatcaaac
gtaaaaggctatcacttatggacgttcatggacaactggtcttggacaaatgcctataaa
aaccgatacggatttgtatcagtcaatcttgagaaaggcggagaaagaaccatcaaaaag
agcggaaaatggttcaaaacggttgctgagcaaaacggtttctag

DBGET integrated database retrieval system