KEGG   Bacillus subtilis subsp. subtilis RO-NN-1: I33_0804Help
Entry
I33_0804          CDS       T01837                                 

Definition
putative glucosidase LplD (EC:3.2.1.-)
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
bsr  Bacillus subtilis subsp. subtilis RO-NN-1
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:bsr00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    I33_0804
  Lipid metabolism
   00561 Glycerolipid metabolism
    I33_0804
   00600 Sphingolipid metabolism
    I33_0804
Enzymes [BR:bsr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     I33_0804
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
760476..761816
Genome map
AA seq 446 aa AA seqDB search
MFHISTLDQIKIAYIGGGSQGWARSLMSDLSIDERMSGTVALYDLDFEAAQKNEVIGNHS
GNRRWRYEAVSTLKKALSAADIVIISILPGSLDDMEVDVHLPERCGIYQSVGDTVGPGGI
IRGLRAVPIFAEIARAIRDYAPESWVINYTNPMSVCTRVLYKVFPGIKAIGCCHEVFGTQ
KLLAEMVTERLGIEVPRREDIRVNVLGINHFTWITTASYRHIDLLPIFREFSAHYGESGY
ELEGESWRDSVFCSAHRVAFDLFETYGAIPAAGDRHLAEFLPGPYLKQPEVWKFHLTPIS
FRKQDRAEKRQQTERLIVQQRGVAGKTSGEEGVNIIAALLGLGELVTNVNMPNQGQVSNL
PIQAIVETNAFITKNGVQPIFSGALPKGVEMLAARHISNQEAVAEAGLTKDTGLAFQAFL
NDPLVQIDRSDAEQLFNDMLQCTMQR
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
gtgtttcatatcagtacattagatcagattaagattgcctatatcggcggggggtcccaa
ggctgggccagaagcctgatgagtgatttgtcgattgatgaacggatgtcaggcacggtg
gcgctctatgatcttgattttgaagccgctcagaaaaatgaagtgatcggcaatcacagc
gggaaccgcagatggagatatgaggctgtttctactttgaaaaaggcgttatcagccgct
gatatcgttattatttccattttgccgggatcactggatgatatggaagtcgatgtccac
ttgcctgagcgctgcggtatttatcagtctgtaggtgatactgtcgggcctggagggatc
atcagaggcttgcgtgctgtgccgatatttgcggaaattgcccgggcaataagagactac
gcacctgaatcatgggtcattaattatacaaacccgatgtctgtctgtacaagagtgctg
tataaagtgtttcccggcatcaaagcgattggctgctgccacgaggtattcgggacgcaa
aagctattggcggaaatggtcacggaaaggctggggatagaggtgccgcggcgtgaagat
atccgcgttaatgtgctcggcattaaccattttacatggatcacaacagcctcttaccgc
catattgacctgctgcctatattccgtgaattcagcgcgcactatggagaatcaggatat
gagctggagggggaaagctggagggacagcgtcttttgttcggcacaccgtgttgcgttt
gatttatttgaaacgtatggcgccatccctgctgcgggtgacaggcatctggcagagttt
cttcccggcccatacctcaaacagcctgaggtatggaaatttcatctcacacctatatca
ttcagaaaacaagacagagctgagaaacgacaacaaacagaacggttgatcgtgcaacaa
cggggcgttgcaggaaaaacttcgggagaagaaggcgtgaacattatagcggctcttctc
ggattgggtgaactcgtcacaaatgtaaatatgccgaatcaaggccaggtctcaaacctt
cctatacaagccattgttgaaacaaacgcattcatcacaaagaacggtgtccagccgatt
ttttccggagcgcttccgaaaggtgtggaaatgctggcggctaggcatatatcgaatcaa
gaggcagtggcggaagccggtttaacaaaggatactggcctcgcgtttcaagctttcctc
aatgacccgcttgtccagattgaccgcagtgatgcagagcagcttttcaatgacatgctc
caatgcaccatgcaacgttga

DBGET integrated database retrieval system