KEGG   Bacillus subtilis subsp. subtilis RO-NN-1: I33_0816Help
Entry
I33_0816          CDS       T01837                                 

Definition
cytochrome P450 family (EC:1.-.-.-)
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
bsr  Bacillus subtilis subsp. subtilis RO-NN-1
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bsr00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    I33_0816
  Amino acid metabolism
   00380 Tryptophan metabolism
    I33_0816
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    I33_0816
Enzymes [BR:bsr01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     I33_0816
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     I33_0816
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
769455..772640
Genome map
AA seq 1061 aa AA seqDB search
MKETSPIPQPKTFGPLGNLPLIDKDKPTLSLIKLAEEQGPIFQIHTPAGTTIVVSGHELV
KEVCDEERFDKSIEGALEKVRAFSGDGLFTSWTHEPNWRKAHNILMPTFSQRAMKDYHEK
MVDIAVQLIQKWARLNPNEAVDVPGDMTRLTLDTIGLCGFNYRFNSYYRETPHPFINSMV
RALDEAMHQMQRLDFQDKLMVRTKRQFHHDIQTMFSLVDSIIAERRSNGDQDEKDLLARM
LNVEDPETGEKLDDENIRFQIITFLIAGHETTSGLLSFATYFLLKHPDKLKKAYEEVDRV
LTDAAPTYKQVLELKYIRMILNESLRLWPTAPAFSLYPKEDTVIGGKFPITTKDRISVLI
PQLHRDRDAWGKDAEEFRPERFEHQDQVPHHAYKPFGNGQRACIGMQFALHEATLVLGMI
LKYFTLIDHENYELDIKQTLTLKPGDFHIRVQSRHQEAIHADVQAAEKAAPDEQKEKTEA
KDASVIGLNNRLLLVLYGSDTGTAEGVARELADTASLHGVRTETAPLNDRIGKLPKEGAV
VIVTSSYNGKPPSNAGQFVQWLQEIKLGELEGVHYAVFGCGDHNWASTYQDVPRFIDEQL
AEKGATRFSARGEGDVSGDFEGQLDEWKKSMWADAIKAFGLELNENADKERSTLSLQFVR
GLGESPLARSYEASHASIVENRELQSADSDRSTRHIEIALPPDVEYQEGDHLGILPKNSQ
TNVSRILHRFGLKGTDQVTLSASGRSAGHLPLGRPVSLHDLLSYSVEVQEAATRAQIREL
AAFTVCPPHRRELEELTAEGVYQEQILKKRISMLDLLEKYEACDMPFERFLELLRPLKPR
YYSISSSPRVNPRQASITVGVVRGPAWSGRGEYRGVASNDLAERQAGDDVVMFIRTPESR
FQLPEDPETPIIMVGPGTGVAPFRGFLQAREVLKREGKKLGEAHLYFGCRNDRDFIYRDE
LEQFKKDGIVTVHTAFSRKEGMPKTYVQHLMADHAETLISILDRGGRLYVCGDGSKMAPD
VEAALQKAYQSVHGTGEQEAQNWLRHLQDTGMYAKDVWAGI
NT seq 3186 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaaacaagcccgattcctcagccgaagacgtttgggccgctcggcaatttgcct
ttaatcgataaagacaagccgacgctttcgctgatcaaactggcggaagaacagggcccg
atttttcaaatccatacacccgcgggcacgaccattgtagtgtccggccacgaattggtg
aaagaggtttgtgatgaagaacggtttgataaaagcattgaaggcgccttggaaaaggtt
cgcgcattttccggtgacggattgtttacgagctggacgcatgagcctaactggagaaaa
gcgcacaacattctgatgccgacgttcagccagcgggccatgaaggactatcatgagaaa
atggtcgatatcgctgttcagctcattcaaaaatgggcaaggctcaacccgaatgaagca
gtcgatgtcccgggagatatgacccggctgacgctcgacaccattgggctatgcgggttt
aactaccgctttaacagttactacagagaaacgccccacccgtttatcaacagcatggtg
cgggcgcttgatgaagcgatgcatcaaatgcagcggcttgattttcaagataagcttatg
gtcagaacaaagcgacaattccaccatgatattcaaacgatgttttcgttagtcgacagc
attattgcagagcgcagatcgaatggagaccaggatgaaaaagatttgctcgcccgcatg
ctgaatgtggaagatccggaaacgggtgaaaagctcgacgacgaaaatatccgctttcag
atcatcacgtttttgattgccggccatgaaacaacgagcggcctgctctcctttgcgacc
tactttttattgaagcatcctgataaactgaaaaaggcgtatgaagaggtcgatcgggtg
ctgacggatgcagccccgacctataaacaagtgctggagcttaaatacatacggatgatt
ttaaatgaatcactgcgcttatggccgacagctccggctttcagcctttatccaaaagaa
gacacagtcattggcggaaaattcccgatcacgacgaaagacagaatttctgtgctgatt
ccgcagcttcatcgtgatcgagacgcttggggaaaggacgccgaggaattccggccggaa
cggttcgagcatcaggaccaagtgcctcatcatgcgtacaaaccattcggaaatggacaa
cgggcttgtatcggcatgcagtttgcccttcatgaagccacacttgtgttaggcatgatt
ctaaaatatttcacgctgattgatcatgagaattatgagcttgatatcaaacaaacctta
acacttaagccgggcgattttcacatcagggttcaaagccgtcatcaggaagccattcat
gcggacgttcaggcagctgaaaaagccgcgcctgatgagcaaaaggagaaaacggaagca
aaggacgcatcggtcattggtcttaacaaccgcctgcttctcgtgctgtacggctcagat
actggcactgcagaaggcgtcgcccgggagcttgctgatactgccagtcttcacggcgta
aggacagagacagcacctctgaacgaccggattggaaagctgccgaaagagggagcggtt
gtcattgtgacctcgtcttataatggaaaaccgccaagcaatgccggacagttcgtgcag
tggcttcaagaaatcaaactgggtgagcttgagggcgtccattacgcggtatttggctgc
ggcgaccacaattgggcgagcacgtatcaagacgtgccgagattcattgatgagcagctt
gcagaaaaaggtgcgactcggttttctgcgcgcggggaaggtgatgtcagcggtgatttt
gaagggcagcttgacgagtggaaaaaaagcatgtgggcggatgccattaaggcattcgga
ctggagcttaatgaaaatgccgataaggaacgaagcacgctgagccttcagtttgtcaga
gggctgggcgagtctccgctggctagatcgtacgaagcctctcacgcatccattgtcgaa
aatcgtgaactccagtctgcagacagcgatcgaagcactcgccatatcgaaattgcattg
ccgccggatgttgaatatcaagagggcgaccatcttggcatattgccaaaaaacagccaa
accaatgtcagccggattctccacagattcggtctgaagggaaccgaccaagtgacattg
tcggcaagcggccgcagtgcagggcatctgccattgggccgccctgtcagcctgcatgat
cttctcagctacagcgtcgaggtgcaggaagcagccacaagagcgcaaatacgtgaattg
gcggcatttacagtgtgtccgccgcatagacgcgaattggaagaactgacagcagagggt
gtttatcaggagcaaatattgaaaaaacgaatttccatgctggatctgcttgaaaagtat
gaagcgtgcgacatgccgtttgaacgatttttagagcttttacggccgttaaaaccgaga
tattattcgatttcaagctctccaagagtgaatccgcggcaagcatcaatcacagtcggt
gtcgtgcgcggccctgcgtggagcggccgtggcgaatacaggggcgtggcttcaaatgat
ttagctgagcgtcaagcgggtgatgatgtcgtgatgtttatccgcacaccggaatcccgg
tttcagcttccagaagaccctgaaacgccaatcattatggtcggaccaggcacaggagtc
gcgccattccgcggtttccttcaagcccgtgaagttttaaagcgggaggggaaaaagctc
ggtgaggctcatctctattttgggtgcaggaacgatcgtgattttatataccgcgatgag
cttgagcagtttaaaaaagacggaatcgtcactgtccatacagccttttcccgaaaagaa
ggcatgccgaaaacatatgtccagcatctcatggctgaccatgcagaaacattaatatcg
attcttgaccgcggaggcaggctttatgtatgcggtgacggcagcaaaatggccccggat
gtggaggcggcacttcaaaaggcgtatcagtctgttcatggcaccggggagcaagaagcg
caaaactggctgagacatctgcaagataccggtatgtacgctaaggatgtctgggcaggg
atatag

DBGET integrated database retrieval system